| Anthropic | | https://jobs.lever.co/Anthropic/eb9e6d83-626c-4f59-8a0e-fa7c413b2014 |
| Imperial College London | | https://www.imperial.ac.uk/jobs/description/MED03708/research-assistantassociate-epidemiology/ |
| American Enterprise Institute | | https://careers-aei.icims.com/jobs/2028/research-assistant%2c-technology-policy-studies/job |
| Chatham House | | https://apply.workable.com/chathamhouse/j/6B87B4CD2D/ |
| Lawrence Livermore National Laboratory | | https://www.llnl.gov/join-our-team/careers/find-your-job/not-applicable_associate_entry-level_internship_globalsecurity_officeofthedirector/all/3743990001434786 |
| The Broad Institute, Sabeti Lab | | https://broadinstitute.wd1.myworkdayjobs.com/en-US/broad_institute/job/Cambridge-MA/Lab-Operations-Manager—The-Sabeti-Lab_36487?q=sabeti+lab |
| Center for Strategic and International Studies | | https://csis-careers.netlify.app/opportunities/1322 |
| Lawrence Livermore National Laboratory | | https://www.llnl.gov/join-our-team/careers/find-your-job/not-applicable_associate_entry-level_internship_globalsecurity_officeofthedirector/all/3743990001435966 |
| Vital Strategies | | https://phg.tbe.taleo.net/phg01/ats/careers/v2/viewRequisition?org=VITASTRA&cws=37&rid=605 |
| Vital Strategies | | https://phg.tbe.taleo.net/phg01/ats/careers/v2/viewRequisition?org=VITASTRA&cws=37&rid=543 |
| University of California, Center for Effective Global Action | | https://cega.berkeley.edu/career/special-projects-associate/ |
| Development Media International | | https://developmentmedia.bamboohr.com/jobs/view.php?id=100&source=bamboohr |
| Global Alliance for Improved Nutrition | | https://jobs.gainhealth.org/vacancies/985/ |
| Malaria Consortium | | https://malariaconsortium.current-vacancies.com/Jobs/Advert/3043458?cid=2061&t=Finance-Manager |
| PATH, Center for Vaccine Innovation and Access | | https://www.linkedin.com/jobs/view/3531965828/?eBP=JOB_SEARCH_ORGANIC&recommendedFlavor=SCHOOL_RECRUIT&refId=4kCRM5TaQkFCX0mjYalGKg%3D%3D&trackingId=ztxbFgLFC6kCQh9prRH7kg%3D%3D&trk=flagship3_search_srp_jobs |
| American Association for the Advancement of Science | | https://workforcenow.adp.com/mascsr/default/mdf/recruitment/recruitment.html?cid=0097f8b0-d7fc-4ca4-a65d-8e1424c01e16&ccId=19000101_000001&___=&jobId=470438 |
| Biobot Analytics | | https://jobs.lever.co/biobot/20e7dad7-dd98-4735-b0b8-2f17dd14e370 |
| IBM | | https://careers.ibm.com/job/17897298/x-force-cybersecurity-apprentice-remote/?codes=WEB_SEARCH_NA |
| Organisation for Economic Co-operation and Development | | https://oecd.taleo.net/careersection/jobdetail.ftl?job=16070&lang=en |
| Anser (US government role) | | https://www.anser.org/careers/opportunity/?jobId=150606e0-a86d-e284-33d3-4c1afafe9e14 |
| Fish Welfare Initiative | | https://www.fishwelfareinitiative.org/ws-opening |
| Gryphon Scientific | | https://apply.workable.com/gryphon-scientific/j/3B1EC3A4DE/ |
| Rockefeller Foundation | | https://workforcenow.adp.com/mascsr/default/mdf/recruitment/recruitment.html?cid=24726181-f57f-46a1-824d-3c8a89c3328a&ccId=19000101_000001&type=MP&lang=en_US&jobId=453241 |
| Mighty Buildings | | https://www.mightybuildings.com/job-detail?gh_jid=4827870004&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Field Marketing AssociateAbout Us:A 9-time Leader in Gartner Magic Quadrant for Enterprise Agile Planning, Digital.ai’s platform is designed to unify, secure, and generate predictive insights across the software lifecycle. Here at Digital.ai, we are dedicated to helping Global 5000 enterprises achieve their digital transformation goals. Digital.ai’s vision is to unlock endless digital possibilities by harmonizing the delivery of software. Our mission is to be THE enterprise platform for artificial intelligence driven software development. About the Role: Digital.ai is seeking a Field Marketing Associate. This position will be responsible for overseeing the logistics for Digital.ai trade shows and field events throughout all stages of the event planning process. The Field Marketing Associate duties include collaborating with internal team members and third-party vendors to ensure successful and timely execution of a diverse number event-related activities.The Field Marketing Associate will be involved in planning and managing events of varying sizes and purposes, including:Maintain a comprehensive plan for tactics and due dates related to each eventOnboard new vendors and submit purchase order requestsCoordinate with a cross-functional Digital.ai team to ensure completion of event-related tasksWork with third party vendors to accomplish event-related tasksComplete trade show form and other event-related forms as neededServe as the project manager on event callsProvide status reports on key event deliverablesTroubleshoot event-related problems and raise for resolution when neededLead aspects of setup and teardown of eventsStaff events as needed and coordinate staff schedulesTravel to participate in events, responsible for site logistics What we are looking for: Bachelor’s degree in Marketing or related field.3+ years demonstrated experience managing trade shows and field events.Proficient in Microsoft Office suiteExperience with Asana project managementExpertise in completing trade show forms and using exhibitor portalsEnjoys the flexibility of a remote work environmentAble to travel 20-25% Why join us at Digital.ai?:Digital.ai offers phenomenal benefits such as:Unlimited PTO in the USComprehensive medical, dental, and vision plansPaid parental leaveUnlimited access to continuous learning and professional development with UdemyFlexible working arrangementsOpportunity to work with a diverse, globally distributed teamDigital.ai is firmly committed to Equal Employment Opportunity (EEO). We maintain compliance with federal, state, and local laws that prohibit employment discrimination on the basis of age, race, color, gender, identity, gender expression, sex, pregnancy, national origin, ancestry, religion, physical or mental ability, medical condition, sexual orientation, marital status, citizenship status, protected military or veteran status, and all other protected classifications. We welcome everyone and believe that diversity is the foundation of innovation.For individuals with disabilities who would like to request an accommodation, please advise us within your job application or cover letter. | https://remotive.com/remote-jobs/marketing/field-marketing-associate-1619697 |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3524251439?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=eyIMPSrE0xxgCQlubY+vhw%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3505605968?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=B8kRWmsaDCTapdOUySb3Uw%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3468524798?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=OWgHAjGZ18H7HS8eERLOiw%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3482565142?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=gHbjrkBhI7Vwv%2F501VsDxQ%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3504270900?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=ahgI0FStXuOsLSD511Qfog%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3468518864?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=2BKe++j0UrAkxifePT5TTA%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3456088818?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=0ScRZrfvx4gyJFjb7m4ZuQ%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3524256129?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=m8uuXIKqMkHLFiICJbK0yQ%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3475905342?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=FrhsNrIdS%2FyoU0cMotwQPw%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3525730678?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=qlBNXkdKmOw0scsxfahITw%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3480609860?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=fXx7K%2FyBbRMpeETznlIG7w%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Coalition for Epidemic Preparedness Innovations | | https://cepi.my.salesforce-sites.com/careers/xcdrecruit__PositionDetails?id=a433z000003lsGxAAI |
| Center for a New American Security | | https://www.cnas.org/careers/program-director-and-senior-fellow-technology-and-national-security-program |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3437820798?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=gGN45V5IeTK7CJoGw%2FPAOQ%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3514711465?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=NwZjtPwitwhdpGxlWyAlFg%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3467044318?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=pYo4MnhKnw5w5sg2AEQ3cA%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3482564137?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=XPxkZTckioulT36yxMfAag%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3524253328?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=GhbBbA2c8G%2Fs4rxdoHSTgA%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3491994748?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=NTLZpzNtJHTOqasFOsHdHQ%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Toggl: Senior Frontend DeveloperHeadquarters: Tallinn, Estonia URL: https://toggl.com/jobs/We are looking for a passionate and sharp Senior Frontend Developer with experience in data visualization to join one of our cross-functional product development teams and help us shape the future of the time tracking industry, delivering real value to our customers by introducing new features and improving the existing ones.The salary for this position is €68,000 annuallyYou can work from anywhere in the world, provided you have an overlap of 4 hours with a European timezone.About the teamWe are a global team of 130+ awesome people working from over 40 countries around the globe. We hire globally, you work locally – in the heart of London, a beach outside of São Paulo, or a quiet village near Florence, the choice is yours. Every few months we travel to meet up somewhere in the world and spend some quality time together. We place a huge amount of trust in our people, and we measure the outcomes rather than the work itself. Our values fuel our results.The roleAs a Senior Frontend Developer, you will play a critical role taking ownership in major projects, using React, JavaScript, TypeScript, HTML and CSS to code slick and fast data visualizations that translate our data into meaningful insights.Your main responsibilities will be:Work closely with other engineers, product managers and designers to understand requirements and translate them into user-friendly web-based componentsDevelop and maintain scalable data visualizations using modern frontend technologies such as React and NivoOptimize frontend performance to ensure fast rendering and smooth interactions for high data volumesConduct code reviews, identify and resolve technical issues, and maintain high coding standardsCollaborate with other development teams to identify and implement best practices in frontend development and related areasAbout you/RequirementsWe would love to hear from you if you have significant experience in frontend development and can lead major development projects. You love working with data visualizations and believe React and web components are the future.In particular, we are looking for:Extensive knowledge about JavaScript and React, and preferably Redux and a side effect managing library like Redux-SagaDemonstrated experience leading large development projects, with good organization skills and the ability to plan well-structured projects, estimate tasks, manage stakeholders and coordinate with other cross-functional teamsA knack for data visualizations, with some familiarity of its principles and best practicesKnowledge about testing frameworks, like JestExcellent communication and collaboration skills, with the ability to work in a remote team environmentStrong problem-solving skills, attention to detail, and ability to work independentlySome benefitsFreedom to choose when and how much you work – we only measure results24 days of paid time off a year, plus your local holidaysIn-person meetups for team-building (expenses covered)4-6 weeks paid sabbatical (depending on the tenure)Laptop budget up to €2,500 and it renews every 3 years€2,000 budget to set up your home office, and additional €300 every year after 3 years of tenure€250 per month for co-working space membership and/or internet service at home€4,000 per year contribution to use for training, workshops, and conferences€2,000 per year contribution for any equipment or services to improve and/or maintain your physical and mental healthSupport for buying tools you need for doing your best work (even eyeglasses if you need a new pair)To apply: https://weworkremotely.com/remote-jobs/toggl-senior-frontend-developer | https://weworkremotely.com/remote-jobs/toggl-senior-frontend-developer |
| Contra: Freelance Website Development at Everyday BrandsHeadquarters: San Francisco, CA URL: http://bit.ly/3kLhMdkWe are looking for a talented Landing page developer to help develop already designed pages inside of Replo Page Builder (similar to Unbounce, Webflow, Gempages, Shogun, Pagefly, etc.)For the most part, we have the design completed inside of Figma, and need these pages transferred over to the page builder.If you can design & develop, this is a bonus. Each page build we take on is anywhere from 5-15 sections, and relatively simple, conversion focused designs. (no animations, etc)To apply: https://weworkremotely.com/remote-jobs/contra-freelance-website-development-at-everyday-brands | https://weworkremotely.com/remote-jobs/contra-freelance-website-development-at-everyday-brands |
| Toggl: Backend EngineerHeadquarters: Tallinn, Estonia URL: https://toggl.com/jobs/We are looking for a passionate and sharp Backend Engineer to be a part of one of our cross-functional product development teams to help us shape the future of the time tracking industry and deliver real value to our customers with both new and improved features.The salary for this position is €63,000 annually and we are committed to increasing salaries every year based on company and individual performance. In addition to that, we also have awesome benefits, which you can check out below.You can work from anywhere in the world.About the TeamWe are a global team of 100+ awesome people working from over 40 countries around the globe. We hire globally, you work locally—in the heart of London, a beach outside of São Paulo, or a quiet village near Florence, the choice is yours. Every few months we travel to meet up somewhere in the world and spend some quality time together. We place a huge amount of trust in our people, and we measure the outcomes rather than the work itself. Our values fuel our results.The RoleAs a Backend Engineer, you will be taking ownership of one or more domains of our product and will work closely with other engineers and product designers in lean ways using cutting-edge technologies powering highly-available RESTful services and back-end systems.The main technologies you will be working with are Go, PostgreSQL and Google Cloud Infrastructure.Even though you can work whenever you want on your tasks, our team meetings can happen between 11:00 to 15:00 UTC. You need to be willing and available to attend these meetings when they happen.Your main responsibilities will be:developing, scaling and maintaining some of our backend services including the API, reports and other infrastructure services that manage our product and logistics worldwideworking with multiple teams day to day to bring more value to Toggl’s users, covering customer-facing web and native applications and public APIscompleting small to medium features independently and in collaboration with frontend engineersresolving most technical issues autonomously and designing well-organized codedriving assigned requests to improve the codebase, such as migrating it to modern frameworks and adding missing testsAbout youWe would love to hear from you if you are passionate about technology and you have some experience with programming in Go.In particular, we are looking for:Strong backend engineering experience in any languagePassion for cross-discipline collaboration and problem-solvingEagerness to learn new skills, and take ownership of your workBonus points for:Working experience with our main technologies: Go, PostgreSQL and Google Cloud InfrastructureExperience with software engineering best practices (e.g. unit testing, code reviews, design documentation)Experience with system architecture, particularly at scaleExperiences with KubernetesBenefitsFreedom to choose when and how much you work – we only measure results24 days of paid time off a year, plus your local holidaysIn-person meetups for team-building (expenses covered)4-6 weeks paid sabbatical (depending on the tenure)Laptop budget up to €2,500 and it renews every 3 years€2,000 budget to set up your home office, and additional €300 every year after 3 years of tenure€250 per month for co-working space membership and/or internet service at home€4,000 per year contribution to use for training, workshops, and conferences€2,000 per year contribution for any equipment or services to improve and/or maintain your physical and mental healthSupport for buying tools you need for doing your best work (even eyeglasses if you need a new pair)To apply: https://weworkremotely.com/remote-jobs/toggl-backend-engineer | https://weworkremotely.com/remote-jobs/toggl-backend-engineer |
| Toggl: Senior Backend EngineerHeadquarters: Tallin URL: https://toggl.com/jobs/We are looking for an experienced Senior Backend Engineer to be a part of one of our cross-functional teams to help us shape the future of the time tracking industry and deliver real value to our customers with both new and improved features.The salary for this position is €70,000 annually.You can work from anywhere in the world.About the TeamWe are a global team of 100+ awesome people working from over 40 countries around the globe. We hire globally, you work locally—in the heart of London, a beach outside of São Paulo, or a quiet village near Florence, the choice is yours. Every few months we travel to meet up somewhere in the world and spend some quality time together. We place a huge amount of trust in our people, and we measure the outcomes rather than the work itself. Our values fuel our results.The RoleAs a Senior Backend Engineer, you will be taking ownership of one or more domains of our product and will work closely with other Backend and Frontend engineers using cutting-edge open source frameworks to highly-available RESTful services and back-end systems.The main technologies you will be working with are Go, PostgreSQL and Google Cloud Infrastructure. Even though you can work whenever you want on your tasks, our team meetings can happen between 11:00 to 15:00 UTC. You need to be willing and available to attend these meetings when they happenYour main responsibilities will be:developing, scaling and maintaining some of our backend services including the API, reports and other infrastructure services that manage our product and logistics worldwideworking with multiple teams day to day to bring more value to Toggl’s users, covering customer-facing web and native applications and public APIsdesigning, breaking down, and completing projects of a medium to large scope with high-level productivitylooking for technical problems of existing system/product without guidance and offering solutionsleading projects with a small group of people, such as hosting weekly meetings, communicating with other partners and stakeholdersAbout youWe would love to hear from you if you strive to solve technical problems of high scope and complexity and have long-standing experience programming in Go.In particular, we are looking for:Strong backend engineering experience in Go;Significant professional experience with distributed systems, PostgreSQL, and Google Cloud Infrastructure;Experience with software engineering best practices (e.g. unit testing, code reviews, design documentation);Experience with performance and optimisation problems, particularly at large scale, and a demonstrated ability to both diagnose and prevent these problems;Ability to work cross-teams and improve cross-functional relationships which will facilitate ongoing projects;Eagerness to make contributions to improve the engineering team. For example, activities like interviewing, or mentoring;Mentor and grow junior engineers;Ability to give on-point and actionable feedback to peers;Effective communication skills: regularly achieve consensus with peers and clear status updates;Collaborate across the company to define, design, build and improve our product;Proficiency in the English language, both written and verbal, is required for success in a remote and largely asynchronous work environment;Bonus points for:Having full-stack experience;Experience with data warehouse and analytics systemsExperiences with Kubernetes at scaleExperience with system architecture at scaleBenefitsFreedom to choose when and how much you work – we only measure results24 days of paid time off a year, plus your local holidaysIn-person meetups for team-building (expenses covered)4-6 weeks paid sabbatical (depending on the tenure)Laptop budget up to €2,500 and it renews every 3 years€2,000 budget to set up your home office, and additional €300 every year after 3 years of tenure€250 per month for co-working space membership and/or internet service at home€4,000 per year contribution to use for training, workshops, and conferences€2,000 per year contribution for any equipment or services to improve and/or maintain your physical and mental healthSupport for buying tools you need for doing your best work (even eyeglasses if you need a new pair)To apply: https://weworkremotely.com/remote-jobs/toggl-senior-backend-engineer | https://weworkremotely.com/remote-jobs/toggl-senior-backend-engineer |
| Toggl: Senior Backend Growth EngineerHeadquarters: Tallin URL: https://toggl.com/jobs/We are looking for an experienced Senior Backend Engineer to be a part of one of our cross-functional teams to help us shape the future of the time tracking industry and deliver real value to our customers with both new and improved features.The salary for this position is €70,000 annually.You can work from anywhere in the world.About the TeamWe are a global team of 100+ awesome people working from over 40 countries around the globe. We hire globally, you work locally—in the heart of London, a beach outside of São Paulo, or a quiet village near Florence, the choice is yours. Every few months we travel to meet up somewhere in the world and spend some quality time together. We place a huge amount of trust in our people, and we measure the outcomes rather than the work itself. Our values fuel our results.The RoleAs a Senior Backend Growth Engineer, you will be taking ownership of Growth team product domain and work in close collaboration with owners and engineers of other key domains, while supporting your team with engineering knowledge. Majority of your work will be by supporting experiments (i.e. A/B testing pre-existing or new features).Your main responsibilities will be:collaborate on the development and maintenance of some of our backend services including reports, payments, and operations tools that manage our product and logistics worldwide.Closely collaborating with product managers and designers, on a day-to-day basis, on discovery and technical analysis level and supporting fellow engineers.working with multiple cross-functional teams to understand problems and implement solutions.designing, breaking down, and completing projects of a small to medium scope with high-level productivity.leading projects with a small group of people, such as hosting weekly meetings, communicating with other partners and stakeholders.About youWe would love to hear from you if you are comfortable with technical, cross functional communication and strive to solve technical problems of high scope and complexity and have long-standing experience programming in Go.In particular, we are looking for:Strong backend engineering experience in Go;Significant professional experience with distributed systems, PostgreSQL and Google Cloud Infrastructure;Experience with software engineering best practices (e.g. unit testing, code reviews, design documentation);Experience with performance and optimisation problems, particularly at large scale, and a demonstrated ability to both diagnose and prevent these problems;Ability to work cross-teams and improve cross-functional relationships which will facilitate ongoing projects;Mentor and grow junior engineers;Ability to give on-point and actionable feedback to peers;Collaborate across the company to define, design, build and improve our product;Experience in technical communication and the ability to communicate complex technical problems to non-technical stakeholders (like Sales, Marketing, Support, etc);Ability to prioritize and manage multiple small-sized projects simultaneously, with a focus on delivering results in small (weekly) cycles.Knowledge of experimental design methodologies, such as A/B testing, and ability to design and implement experiments to drive growth;Proficiency in the English language, both written and verbal, is required for success in a remote and largely asynchronous work environment.Bonus points for:Having full-stack experience;Understanding of customer behavior, needs, and motivations and ability to use this information to inform experiment design;Ability to generate new and unique ideas for growth experiments and a willingness to take calculated risks;Experience with best practices in Agile Software Development;Eagerness to make contributions to improve the engineering team. For example, activities like interviewing, or mentoring;BenefitsFreedom to choose when and how much you work – we only measure results24 days of paid time off a year, plus your local holidaysIn-person meetups for team-building (expenses covered)4-6 weeks paid sabbatical (depending on the tenure)Laptop budget up to €2,500 and it renews every 3 years€2,000 budget to set up your home office, and additional €300 every year after 3 years of tenure€250 per month for co-working space membership and/or internet service at home€4,000 per year contribution to use for training, workshops, and conferences€2,000 per year contribution for any equipment or services to improve and/or maintain your physical and mental healthSupport for buying tools you need for doing your best work (even eyeglasses if you need a new pair)To apply: https://weworkremotely.com/remote-jobs/toggl-senior-backend-growth-engineer | https://weworkremotely.com/remote-jobs/toggl-senior-backend-growth-engineer |
| Social Media Marketing SpecialistAbout Appsilon Appsilon is an ambitious and fast-growing software house and consultancy specializing in actions support systems and machine learning with Fortune 500 clients across the globe. We are a unique company inspired by a mission to improve our society and environment. We are a global leader in R and Shiny, which are used by companies of all sizes to build data applications. When companies run into difficult problems or want to initiate large-scale enterprise projects, they come to Appsilon. Before you apply, please read our code of conduct. We are looking for someone creative who is a dynamite and will add ENERGY to our social media. We are not looking for a regular social media manager, we are looking for someone who is fascinated by social media and wants to explore them. We want you to build new spicy social media for us! Make them fresh, crispy, funny and respectful. Make them visible… make them Shiny. This is a part time role for the beginning but we’re open to extending it to full time.This spot is for you if:You’re creative!Experience in dev marketing (cooperation with any software house),2 years of experience in social media marketing ,Experience in creating video clips.Your love of social media has no limits,You inspire others with positive energy,You’re like Merry and Pippin in the fellowship of The Ring – curious, occasionally breaking the patterns and full of good humour,You like and know how to get inspired by others’ social media and create something unique and fresh from it,You agree that social media is a tool to generate leads and connect with customersYou know how to use short videos in social media,Your English is great (C1), As a Social Media Magician you will:Write creative and imaginative, innovative tweet content including post propositions for main stakeholders,Do a research of tweets of our competitors and influences in the world of R,Use analytical tools to analyse TW and LI and follow up of how we need to change our SM to adjust it to new algorithms,Coach people active on social media so that they achieve better results in creative way,Pass knowledge for the team what is important to build your brand on different platforms,Tweet creative snippets for key people that would be of higher quality,Manage social media ads,Introduce Appsilon to YT shorts and TikTok .Why Appsilon is a good place for you:Company values/mission – we invest in being a force of good through theData4Good project,We can help you develop your skills with us,We offer attractive compensation with extensive human-first, people-focused,Benefits to prioritize your personal and financial well-beingOpen, kind, and understanding internal culture,We are specialists in our core technology, well known in the market,R/Shiny Community watches us and likes to talk to us :),High impact on the work of the whole company,,We have an amazing Team, ready to support you,Start-up atmosphere, less documentation and rules, we are open to experimenting and learning, A very short decision-making process with almost flat structure,Appsilon is remote-only.What’s in it for you5000 PLN + VAT on B2B/monthly / Part time26 days of paid holidays + an equivalent of public holidays in Poland, est. 11 days in 202233 paid sick leave days / year (paid 80%)+5% of salary in Professional Development Budget to spend on activities that help you growOpen hours with Head of Finance – to consult Polish taxation law.Remote work with flexible working hours adjusted to your time zone and family life.4 paid days per year to be used for training/conferences, events, or workshopsPrivate health care insurance (in Poland) or cash equivalent if you’re not in PolandFitProfit or FitSport membership card (in Poland) or cash equivalent if you’re not in PolandLife insurance for you and your familyAskHenry – a personal assistantWhat can you expect during the recruitment process?Recruiter callTaskHiring manager callAppsilon is committed to being a diverse and inclusive workplace. We encourage applicants of different backgrounds, cultures, genders, experiences, abilities, and perspectives to apply. All qualified applicants will receive consideration for employment without regard to race, color, national origin, religion, sexual orientation, gender, gender identity, age, physical disability, or length of time spent unemployed. Does this sound like a great opportunity for you? Use the Apply button below! | https://remotive.com/remote-jobs/marketing/social-media-marketing-specialist-1621047 |
| Senior Front End EngineerWe’re looking for…An extremely talented Senior Front End Engineer to help pioneer a completely new type of insurance globally. Who are you?You have excellent communication skills – verbal and writtenYou have great management skillsYou should have experience designing and building large and complex (yet maintainable) systems, websites and appsYou are able to work in a third of the time that most competent people think possibleYou are driven by challengesIncredibly detailed orientedYou can collaborate with back end engineers in ensuring technical feasibilityYou have Experience working in an agile development environment What’s the role?You will be responsible for:A diverse range of tasks requiring development across various UI layers from mail design and implementation to front end website dev including: CSSHTMLJavaScript (Node9js, Typescript, React)A large part of the build will be Greenfields work Boxes to tick…MatricTertiary Qualification – BSc, Msc or PhD in Computer Science, Engineering or the equivalentA minimum of 4+ years of relevant experienceExcellent HTML5, CSS and JavaScript (React) knowledgeExperience with UX/UI/Product design patternsNext.js, MJML or other mail markup language knowledge – advantageous | https://remotive.com/remote-jobs/software-dev/senior-front-end-engineer-1629432 |
| Junior Software EngineerWe are seeking a talented and passionate individual to join our team as an Entry Level Junior Software Engineer. As a Junior Software Engineer, you will be responsible for developing and maintaining software applications that meet the needs of our customers. This is a remote position based in the USA and an excellent opportunity for anyone looking to start their career in software engineering.Responsibilities:Collaborate with cross-functional teams to identify software development needsDevelop software applications and features that meet customer needsDebug and troubleshoot issues in existing software applicationsWrite and maintain code documentation and testsParticipate in code reviews and contribute to the overall software development processKeep up-to-date with emerging trends and technologies in software developmentQualifications:Bachelor’s degree in Computer Science or a related fieldStrong problem-solving and analytical skillsProficiency in at least one programming language such as Java, Python, or C++Familiarity with software development principles and best practicesExcellent communication and collaboration skillsAbility to work independently in a remote environmentBenefits:Competitive salary and benefits packageOpportunities for career growth and developmentFlexible work schedule and remote work optionsCollaborative and supportive team cultureIf you’re passionate about software engineering, problem-solving, and want to make an impact in a dynamic and growing organization, we encourage you to apply for this exciting opportunity. We are an equal opportunity employer and welcome all qualified applicants to join our team. | https://remotive.com/remote-jobs/software-dev/junior-software-engineer-1629860 |
| Nuclear Threat Initiative | | https://www.nti.org/job-listing/development-manager/ |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3522209220?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=TgadkkPsmqlJ7Mo51no9Hw%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3364427932?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=IKxNY9dKD87O23ovLOoIvQ%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Unreal Game Client EngineerTidal Flats is a NFT Creative Studio powered by MetaZ. Project Fidelion, Second project by Tidal Flats is an IP project for a post-apocalyptic Web3 game directed by the legendary AD, Hokyo Lim, Co-Founder of Riot Games. We aim to bring an IP value that can be connected inside and outside the gaming industry. Our vision is to provide you with a lifetime memory through the art and story of Fidelion.Meta Z Website: https://www.meta-z.io/enFidelion Website: https://fidelion.ioResponsibilitiesMaintain the global user-targeted P2E game client.Analyze and implement game systems and content requirements.RequirementsAbility to program your own ideas.Experience developing small-scale projects from start to launch.Strong communication skills to work with diverse team members.Experience with Unreal commercial project launches.Experience with development using Unreal Engine.Strong knowledge and understanding of data structures, algorithms, and object-oriented development.Experience optimizing for mobile platforms.Language: C++Preferred QualificationsExperience with various casual game projects.Experience in developing strategy games and ARPGs.Experience developing or playing NFT P2E games.How We WorkFull-remoteDaily scrum meetingApplication ProcessApply → Programming Quiz → Interview → On-board The interview will take approximately an hour. Interview will proceed online remotely.If you submit the google form we attached, we will contact you in 3 days.Click this link to apply: https://forms.gle/i6dwVpXueb3DwbD26We thank all that apply; however only the most qualified candidates selected for an interview will be contacted. | https://remotive.com/remote-jobs/software-dev/unreal-game-client-engineer-1630549 |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3482563246?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=bj1cEOmVWgbVcZRQzUOpcQ%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3522212237?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=awnxK72ppIX%2FGg9gPAaeGw%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3469834158?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=wj12QEmhkgdkM0sMYdh7UQ%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Frontend DeveloperIn this role, you’ll be responsible for developing mobile-first, responsive front ends that are used millions of times per day. We wrote our frontend from scratch in VueJS about 3 years ago, so you’ll be working with the latest technology instead of wrangling with decades-old spaghetti code. A willingness to work in VueJS is fine – as long as you are willing to learn and have demonstrable experience in a similar frontend framework.Our Stack (we don’t expect you to have all of these) Vue + Vuex + Vue Router + Webpack + Less + SCSSElement UIFreeMarkerAWS, Circle, Drone CI, K8sResponsibilitiesDevelop mobile-first frontends in VueJsFocus on performance and user experienceCreate frontends for the backend management systemsParticipate in code reviews with peers and managers to ensure that each increment adheres to original vision as described in the user story and all standard resource libraries and architecture patterns as appropriateParticipate in team ceremonies including planning, grooming, product demonstrations, and team retrospectivesMentoring less experienced team membersRequirementsFamiliarity with at least one: Vue, React, AngularFamiliarity with Git, ES6, Webpack, Less or Sass, and NodeJSFamiliarity with state management like Vuex, Redux, NgrxExcellent communication skills Knowledge of backend stack is a plus BenefitsQuarterly and flash bonusesFlexible working hoursTop-of-the-line equipmentReferral bonuses28 days paid annual leaveAnnual company retreat – we all went to Dubai in 2022 and are planning 2 more retreats for 2023!Highly talented, dependable co-workers in a global, multicultural organisationPayment via DEEL, a world class online wallet system We score 100% on The Joel TestOur teams are small enough for you to be impactfulOur business is globally established and successful, offering stability and security to our Team MembersInterview ProcessHackerRank Test Remote 90 min video interview loop with 3 x Team Members (30 mins each)24-72 hour feedback loops throughout process | https://remotive.com/remote-jobs/software-dev/frontend-developer-1570346 |
| Freelance Website DevelopmentI’m looking for help building a website for a new event space. A team would include a web developer and a content writer.The concept is a new nightclub in Dubai called CIPHER, an electronic music-oriented venue that we hope will welcome some of the best DJs in the world, names like Afterlife, Charlotte De Witt, Black Coffee etc.As such, we need a website that fully reflects our brand identity (being worked on in parallel).The feeling of this space in terms of design can be described as ‘elevated minimalist’, with dark tones throughout the venue and the use of materials like brass and concrete.The visual identity of the website needs to match the vibe of the space.Some of our inspirations include venues like Input in Barcelona, Berghain and Tresor in Berlin, Printworks in London, The Brooklyn Mirage, Bassiani in Tiblisi etc.The websites for these venues also have some of the core functionalities we would like, namely the ability to publish events and ticket them to the public.Ticketing functionality is key, in UAE dirhams, and with the ability to offer Pre-sale, 1st release, 2nd release and final release tickets, before listing events as ‘sold out’. This can of course be achieved with some external, ready solution. Platinum List is the market leader in the region and would be the best likely integration.Every event will have a single piece of conceptual artwork to also be displayed.The website needs to be easy to navigate. https://www.avant-gardner.com/ (the website for Brooklyn Mirage) probably is the most similar to what we require in terms of content, i.e., Events publication (easy-to-use back-end for our team) called ‘What’s On’, Tables, Hire, Info, Merch, Contact Us, GalleryUnder ‘Info’ I would like to have another menu or a page with links like https://printworkslondon.co.uk/info/ with FAQs, About Us, Jobs, Membership, and Accommodation as the options.On ‘Tables’, the user should have a simple form where they can first select the event they are interested in, and then input info such as their name, contact details, number of guests, etc that is sent to an email address used by the reservations team, or use a whatsapp link that connects them to our reservations team directly. They will then come back to them with pricing info.‘Hire’ should mimic https://printworkslondon.co.uk/hire/‘Merch’ should have a simple Shopify store‘Contact us’ can mimic https://www.avant-gardner.com/contact-1And lastly ‘Gallery’ can again be super simple, like https://printworkslondon.co.uk/gallery/ with an easy back-end to upload images (no text content)We would somewhere also need links to our socials; Instagram, tiktok, facebook, twitterCertainly lots more to think about, but this is a start. | https://remotive.com/remote-jobs/software-dev/freelance-website-development-1632016 |
| Mattoboard | Skip to main contentLinkedInJobsDismissDismissJoin nowSign inBlender Scripting EngineerMattoboard United States2 days ago Be among the first 25 applicants See who Mattoboard has hired for this roleApplySaveMattoboard is looking for a software engineer that is excited about hard engineering problems and wants to push the state of the art. Strong Blender/Python experience is necessary and should have an understanding of the PBR workflow and be able comfortable working with Blender programmatically. Having a strong design sense is important but this primarily a hard engineering problem.At Mattoboard we have built a WebGL tool for designers. We have a successful proof of concept of mapping the scene graph back to Blender and we are now looking for the right person to bring this to production.Demo of our product is here! https://www.youtube.com/watch?v=eq5pjNL1GGMThis is a contract position but we would be happy to bring the right person on full time. As an early stage startup we fully remote and very flexible in figuring out the right work situation.Thank you!Show more Employment typeContract Referrals increase your chances of interviewing at Mattoboard by 2xSee who you knowGet notified about new Engineer jobs in United States.Sign in to create job alertSimilar jobsMedical DirectorMedical DirectorNeuroglee TherapeuticsBoston, MA9 minutes agoLicensed Insurance Agent – Avg $120k First YearLicensed Insurance Agent – Avg $120k First YearInsurTech AdvisorsUnited States2 minutes agoCleaning Operations Supervisor – QLD MetroCleaning Operations Supervisor – QLD MetroCity FM AustraliaBrisbane, Queensland, Australia3 minutes agoFinance ManagerFinance ManagerApeiron BioenergyPathum Thani, Thailand12 minutes agoCRNA Casual Part Time – Alfred I duPont HospitalCRNA Casual Part Time – Alfred I duPont HospitalNemoursWilmington, DE3 minutes agoVape Sales Representative in Europe and the USVape Sales Representative in Europe and the USHiredChina.com 为中国企业链接国际人才Hauts-de-France, France9 minutes agoShow more jobs like this People also viewedRisk Underwriting Technology AnalystRisk Underwriting Technology AnalystHome Credit IndonesiaJakarta, Indonesia2 minutes agoDeveloper Relations ManagerDeveloper Relations ManagerAlibaba CloudJakarta, Jakarta, Indonesia3 minutes agoMedia ExecutiveMedia ExecutiveZenithHong Kong, Hong Kong SAR5 minutes agoTransportation Department SupervisorTransportation Department SupervisorRightPro StaffingSt Albans, VT7 minutes agoPerformance test engineer (Trivandrum/ Cochin)Performance test engineer (Trivandrum/ Cochin)USTTrivandrum, Kerala, IndiaJust nowBenefits Analyst (Manager)Benefits Analyst (Manager)ConnectedGroupHong Kong, Hong Kong SAR1 minute agoLaboratory TechnicianLaboratory TechnicianFulton HoganMackay, Queensland, Australia13 minutes agoSenior MicroStation DrafterSenior MicroStation DrafterKBR, Inc.Melbourne, Victoria, AustraliaJust nowHome Infusion Nurse – Accredo – Houston, TXHome Infusion Nurse – Accredo – Houston, TXEvernorth Health ServicesHouston, TX3 minutes agoSales DirectorSales DirectorModa | Ecommerce GrowthBengaluru, Karnataka, India1 minute agoLooking for a job?Visit the Career Advice Hub to see tips on interviewing and resume writing.View Career Advice HubLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyYour California Privacy ChoicesCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/jobs/view/blender-scripting-engineer-at-mattoboard-3525723129?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| AlGooru | Skip to main contentLinkedInJoin LinkedInEmailPassword (8+ characters)By clicking Agree & Join, you agree to the LinkedIn User Agreement, Privacy Policy, and Cookie Policy.Agree & JoinAlready on Linkedin? Sign inOn LinkedIn, applicants are 4X more likely to get hired through their networkLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://lb.linkedin.com/jobs/view/tutor-sourcing-analyst-at-algooru-%D8%A7%D9%84%D9%82%D9%88%D8%B1%D9%88-3530755825?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| AlGooru | Skip to main contentLinkedInJoin LinkedInEmailPassword (8+ characters)By clicking Agree & Join, you agree to the LinkedIn User Agreement, Privacy Policy, and Cookie Policy.Agree & JoinAlready on Linkedin? Sign inOn LinkedIn, applicants are 4X more likely to get hired through their networkLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://ae.linkedin.com/jobs/view/retention-lead-at-algooru-%D8%A7%D9%84%D9%82%D9%88%D8%B1%D9%88-3526392162?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| MegaFans | Skip to main contentLinkedInJobsDismissDismissJoin nowSign inProject ManagerMegaFans Esports United States3 weeks ago Over 200 applicants See who MegaFans Esports has hired for this roleApplySaveDirect message the job poster from MegaFans EsportsJeff DonnelleyMEGAFANS esports SAAS platform lowers CAC and increases user LTV for Web2+Web3 developers #MightyLabsDAOWe’re hiring a Project Manager at Megafans as we add more games and collaborate with the blockchain industry. If you know anyone who is experienced and skilled in the project management area of esports, gaming or blockchain technology, feel free to send their resume here or to [email protected] to apply. The ideal candidate will be responsible for planning, coordinating, and implementing projects within the decided-upon budget, timeline, and scope. They will also effectively monitor and present project updates to relevant stakeholders, clients, or project team members. ResponsibilitiesSet project timelines and KPIs to meet OKRsMonitor project deliverables to meet OKRsUpdate relevant stakeholders or team members on the project progressCoach and support project team members with tasks you assign themReport and optimize process for maximum outputShow responsibility for project P&Ls QualificationsBachelor’s Degree or equivalent 4+ years experienceStrong business acumen in project planning and managementStrong verbal, written, and organizational skillsShow more Employment typeFull-time Referrals increase your chances of interviewing at MegaFans Esports by 2xSee who you knowGet notified about new Project Manager jobs in United States.Sign in to create job alertSimilar jobsSr. Account Sales Engineer – SemiconductorSr. Account Sales Engineer – Semiconductor上海森介商务咨询有限公司Shanghai, China3 minutes agoLicensed Insurance Agent – Avg $120k First YearLicensed Insurance Agent – Avg $120k First YearInsurTech AdvisorsUnited States2 minutes agoCleaning Operations Supervisor – QLD MetroCleaning Operations Supervisor – QLD MetroCity FM AustraliaBrisbane, Queensland, Australia3 minutes agoFinance ManagerFinance ManagerApeiron BioenergyPathum Thani, Thailand12 minutes agoCRNA Casual Part Time – Alfred I duPont HospitalCRNA Casual Part Time – Alfred I duPont HospitalNemoursWilmington, DE3 minutes agoAnalyste Trésorerie – Opérations de Marché F/HAnalyste Trésorerie – Opérations de Marché F/HDassault SystèmesVélizy-Villacoublay, Île-de-France, FranceJust nowShow more jobs like this People also viewedDeveloper Relations ManagerDeveloper Relations ManagerAlibaba CloudJakarta, Jakarta, Indonesia3 minutes agoMedia ExecutiveMedia ExecutiveZenithHong Kong, Hong Kong SAR5 minutes agoMainframe DeveloperMainframe DeveloperTata Consultancy ServicesPune, Maharashtra, India5 minutes agoTransportation Department SupervisorTransportation Department SupervisorRightPro StaffingSt Albans, VT7 minutes agoPerformance test engineer (Trivandrum/ Cochin)Performance test engineer (Trivandrum/ Cochin)USTTrivandrum, Kerala, IndiaJust nowAccount ManagerAccount ManagerPublicis Groupe SingaporeSingapore, SingaporeJust nowLaboratory TechnicianLaboratory TechnicianFulton HoganMackay, Queensland, Australia13 minutes agoSenior MicroStation DrafterSenior MicroStation DrafterKBR, Inc.Melbourne, Victoria, AustraliaJust nowHome Infusion Nurse – Accredo – Houston, TXHome Infusion Nurse – Accredo – Houston, TXEvernorth Health ServicesHouston, TX3 minutes ago(Senior) Account Manager, eLearning Sales(Senior) Account Manager, eLearning SalesHKT HomeHong Kong, Hong Kong SAR4 minutes agoLooking for a job?Visit the Career Advice Hub to see tips on interviewing and resume writing.View Career Advice HubLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyYour California Privacy ChoicesCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/jobs/view/project-manager-at-megafans-esports-3477447899?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Contently | Solutions Case StudiesFreelance ContentlyU About SIGN INREQUEST A DEMOAccount ExecutiveAccount Executive (Remote – East Coast Centric)Reporting Into: Head of SalesCompensation Range: $150k-$220k 50/50 OTE based on experienceContently is looking for ambitious, consultative content marketing sales professionals (SaaS experience a MUST HAVE) who want to financially prosper in a dynamic startup. In this role you’ll be empowered to prospect, build relationships and close business with the Marketing and Content teams of Fortune 1000 companies. The ideal candidate drives business by helping customers understand how Contently empowers them to create custom content at scale, more deeply engage with their audiences and deliver accountable business outcomes.What You’ll Do: Effectively engages with new prospects and wins deals by using a consultative, value oriented approach that resonates with high level decision makersThey seek first to understand, ask probing questions, heavily research the prospect business before engaging.Demonstrates a high level of business acumen by effectively discussing the business needs of prospects to align Contently fit before presenting valueLoves the hunt of prospecting and wants to scale their pipeline beyond Lead Gen team contribution in order to exceed targetDrives the entire sales process from prospecting through opportunity development and deal closure, to post-sale kickoff with our Customer Success teamIs passionate about content marketing and MarTech solutions, thus endearing them to prospects as a trusted resourceDesire to work in a dynamic startup where they can share feedback from the field to help shape the evolution of our product and service offeringsWho You Are:A skilled, enterprise logo, VP+ level hunter 3+ years of direct to brand, content marketing SaaS salesProven track record of exceeding targets by running a consultative sales process with large, complex prospect organizationsExperience selling content programs with a consultative approachThrived and demonstrated flexibility in a fast-paced, dynamic environmentDeep understanding of content marketing and/or the value delivered by MarTech solutionsTruly helped customers and performed for managers so that both will be pleased to be your reference if selected to work at ContentlyEnjoys contributing to company culture that celebrates performance, diversity and the participation of all employeesWhat We ValueHigh-performing creative leaders who have a solution mindset and dig into problems and opportunities with fervor and enthusiasmLeaders who actively participate at all levels of building the business, not afraid to advocate for recommended solutions and promote Humility and accountability; focused on the right solution, collaboration, and empowering their employeesWe heavily emphasize an environment of teaching and learning to equip employees with the tools needed to be successful in their function and the company.Async and fluid work environment through family friendly policies, remote benefits and flexible time offWe strongly believe in the value of growing a diverse team and encourage people of all backgrounds, genders, ethnicities, abilities, and sexual orientations to apply.About the CompanyContently is a leader in the content marketing space as the industry’s only end to end solution for the problems facing today’s marketers. We are a software company whose full stack platform has hundreds of applications. This includes our data-driven content strategy and network of 160,000 award-winning content creators, which empowers you to build meaningful relationships with your customers.Working at Contently means that you will be collaborating with extremely intelligent, creative, and diverse problem-solvers who love a good story and many laughs. Contently employees receive the best perks out there – great benefits including a 401k plan, ContentlyYOU Wellness Stipend, Wellness Fridays and a flexible vacation policy.Contently is proud to be an Equal Opportunity Employer. We do not discriminate based upon race, religion, color, gender, gender identity or expression, sexual orientation, genetic information, national origin, ancestry, medical condition, disability, marital status, caregiver status, pregnancy, citizenship, age, military or veteran status, or other applicable legally protected characteristics. Job Application:First Name*Last Name*Email*PhoneResume/CV*UPLOADCover LetterUPLOADWhat are you base salary expectations? What are you total OTE expectations?*Will you now or in the future require sponsorship for an employment visa? *Please selectNoYesLinkedIn Profile*Why Contently?SUBMIT44 Wall Street13th FloorNew York, NY 10005SIGN INWhat we doContent SolutionsContent Marketing PlatformContent CreatorsContent Marketing ServicesCase StudiesOn-Demand DemoWho we areAbout UsContact UsCultureCareersNewsContentlyUContentlyU HubThe Content StrategistThe Freelance CreativeGigsSign up for The Content Strategist’s newsletter and join a community of more than 200,000 of the world’s best marketers.SUBSCRIBEFollow us on social media Are you a creative freelancer? Visit Contently.net© Contently 2023Terms of Service Privacy Policy | https://contently.com/careers/account-executive-18/?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Wynd | Skip to main contentLinkedInJoin LinkedInEmailPassword (8+ characters)By clicking Agree & Join, you agree to the LinkedIn User Agreement, Privacy Policy, and Cookie Policy.Agree & JoinAlready on Linkedin? Sign inOn LinkedIn, applicants are 4X more likely to get hired through their networkLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://fr.linkedin.com/jobs/view/stage-6-mois-juriste-at-anycommerce-3494784278?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Wynd | Skip to main contentLinkedInJoin LinkedInEmailPassword (8+ characters)By clicking Agree & Join, you agree to the LinkedIn User Agreement, Privacy Policy, and Cookie Policy.Agree & JoinAlready on Linkedin? Sign inOn LinkedIn, applicants are 4X more likely to get hired through their networkLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://fr.linkedin.com/jobs/view/d%C3%A9veloppeur-web-stage-6-mois-minimum-at-anycommerce-3494438006?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Wynd | Skip to main contentLinkedInJoin LinkedInEmailPassword (8+ characters)By clicking Agree & Join, you agree to the LinkedIn User Agreement, Privacy Policy, and Cookie Policy.Agree & JoinAlready on Linkedin? Sign inOn LinkedIn, applicants are 4X more likely to get hired through their networkLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://fr.linkedin.com/jobs/view/alternance-strat%C3%A9gie-et-business-d%C3%A9veloppement-12-24-mois-at-anycommerce-3490962552?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3510691455?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=sI3cMrvAf8eUU1XKchsOpA%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Wynd | Skip to main contentLinkedInJoin LinkedInEmailPassword (8+ characters)By clicking Agree & Join, you agree to the LinkedIn User Agreement, Privacy Policy, and Cookie Policy.Agree & JoinAlready on Linkedin? Sign inOn LinkedIn, applicants are 4X more likely to get hired through their networkLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://fr.linkedin.com/jobs/view/offre-alternance-administrateur-syst%C3%A8me-tendance-devops-sysops-at-anycommerce-3523768913?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Wynd | Skip to main contentLinkedInJoin LinkedInEmailPassword (8+ characters)By clicking Agree & Join, you agree to the LinkedIn User Agreement, Privacy Policy, and Cookie Policy.Agree & JoinAlready on Linkedin? Sign inOn LinkedIn, applicants are 4X more likely to get hired through their network | https://fr.linkedin.com/jobs/view/administrateur-syst%C3%A8me-tendance-devops-sysops-at-anycommerce-3523776025?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3452504278?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=6su8rRw0JK+gfKCx9dWlHA%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Towntalk Solutions | This site can’t be reachedng.linkedin.com took too long to respond.Try:Checking the connectionChecking the proxy and the firewallERR_TIMED_OUTReloadDetails | https://ng.linkedin.com/jobs/view/lead-developer-at-towntalk-techstars-%E2%80%9922-3521142939?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Koala | AccueilTrouver un jobTrouver une entrepriseMédiaDevenir clientSe connecterWho are they?Job descriptionPreferred experienceRecruitment processKOALAExperienced TypeScript Backend DeveloperCDI Salaire entre 61K € et 73,5K €51 Rue Lepic, Paris, 75018Télétravail partiel possibleÉducation : Non spécifiéExpérience : > 5 ansL’ENTREPRISEKoalaFinTech / InsurTech< 15 salariésLE POSTEExperienced TypeScript Backend DeveloperCDI Salaire entre 61K € et 73,5K €51 Rue Lepic, Paris, 75018Télétravail partiel possibleÉducation : Non spécifiéExpérience : > 5 ansPostulerWho are they?🐨 About the KoalaTravelling is meant to be relaxing and enjoyable, but unfortunately, disruptions happen more often than we hope, causing stress and anger. These disruptions are often difficult to deal with, including long wait times, and are rarely compensated. This is where Koala comes in.Our mission is to offer peace of mind from the moment travellers book their trips to the minute they return home.Our goal is to help our partners delight their customers while generating revenue. We build our products from scratch with the same philosophy: automating 100% of the operations while removing all the frictions of an insurance product. And it works!Our products are already distributed in 11 countries and purchased by over 200,000 travellers. As a bonus, we are alumni of Techstars.Join us on our quest to reinvent travel insurance and set Koala as the standard in customer experience. We are looking for a mission-driven developer to help us change the market.Company cultureA voice in every decision being takenAn environment for you to keep learning and further develop your skillsAn opportunity to be a key contributor in building a global product that will be used by millionsA financial incentive in the company’s success (equity package)Flexible remote policy (no-flex office, ideally at least 2 days on-site)Want to know more about Koala?Company culture, teams, technical stack, jobs… Let’s go for an immersion!Visit the profileMeet Ugo, CEOMeet Alexandre, Full Stack DeveloperMeet Suvendu, Head of InsuranceJob descriptionDo you want to participate in building a large-scale, ambitious yet realistic project? To be part of an involved and passionate team, which values initiative and progress? Do you want to have your say in the design of a product that will raise the standards of the travel insurance industry? Welcome to Koala.How?By building a robust, product-driven technical stack, which cores is a stable, fast and scalable API for our partners to integrate with.By also putting a strong emphasis on developer experience through clear documentation and recipes.MethodologyExhaustive internal documentationCode reviewsOwnership (Tech Holder)BackendTypeScriptNode.js, NestJS, PostgresZod, Prisma, XStateJestInfrastructureCDK (infrastructure as code)ECS (container orchestration) / Fargate (compute engine)Lambda (serverless compute)EventBridge (event bus) / SQS (queues)DynamoDB (document database) / AWS RDS (Aurora) (relational database)Step Functions (orchestration)Kinesis Data Streams / Kinesis Data Firehose / AthenaPreferred experienceMust haveTypeScript & EcosystemSoftware craftsmanshipDealt with Node.js-based API at scaleProfessional EnglishStrong communication skillsNice to haveProfessional FrenchExperience in an early startupKnows the concept of Event-Driven ArchitectureExperience with some of our core libs (Nest, Zod, Prisma)Experience in cloud native architectureKnows AWSManagement proficiencyAbsolute BonusKnows the fundamentals of insuranceRecruitment process30-min call with Antony (founder and CTO) to talk about the company, the technical stack and ensure the technical fitHomework (technical test)Immersion with your future teammates, including a deep dive in your previous experiences and some roleplayKOALACette offre vous tente ?PostulerQUESTIONS AND ANSWERS ABOUT THE OFFERIs it mandatory to send a CV?Does this position allow remote work?What type of contract is offered for this position?Is a cover letter mandatory to apply for this position?D’autres offres de Dev BackendCes offres peuvent vous intéresser !DatadogLibrary Software Engineer – JavaCDIParisTélétravail total possibleil y a 4 heuresGroupe SIIDéveloppeur Cobol (H/F)CDIParisil y a 4 heuresPhotoRoomSenior Backend EngineerCDIParisTélétravail total possibleil y a 6 heuresHunteedDéveloppeur Back-End Node.js H/FCDIParisil y a 14 heuresOpenConcepteur développeur java / devops (H/F)CDILevallois-PerrethierStocklySoftware Engineer (Rust, gRPC, PostgreSQL) – CDI – ParisCDIParisavant-hierVoir toutes les offresNous construisons la nouvelle expérience au travailA PROPOSConceptQui sommes-nous ?Offres d’emploiOffres de stageCentre d’aideNOUS RENCONTRERHuman After AlldotConferencesPresseJobsTarifsCandidats : besoin d’aide ?Assistance entrepriseLA NEWSLETTER QUI FAIT LE TAFUne fois par semaine, des histoires, des jobs et des conseils dans votre boite mail.Abonnez-vous !Vous pouvez vous désabonner à tout moment. On n’est pas susceptibles, promis. Pour en savoir plus sur notre politique de protection des données, cliquez-iciDevenir clientConnexion clientMentions légalesCGUPolitique de confidentialitéCharte Welcome to the JunglePolitique cookiesGestion des cookiesFrance (FR)Axeptio consent | https://www.welcometothejungle.com/fr/companies/koala-insurance/jobs/experienced-typescript-backend-developer_paris?q=2cea5d1e4b84ee4ccee1674c68582dd6&o=1694679&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Koala | AccueilTrouver un jobTrouver une entrepriseMédiaWho are they?Job descriptionPreferred experienceRecruitment processKOALASenior Product ManagerCDI Salaire : 60K €51 Rue Lepic, Paris, 75018Télétravail partiel possibleÉducation : Bac +5 / MasterExpérience : > 5 ansL’ENTREPRISEKoalaFinTech / InsurTech< 15 salariésLE POSTESenior Product ManagerCDI Salaire : 60K €51 Rue Lepic, Paris, 75018Télétravail partiel possibleÉducation : Bac +5 / MasterExpérience : > 5 ansPostulerWho are they?🐨 About Koala:Founded in 2018, Koala is a travel insurtech on a mission to offer peace of mind from the moment travellers book their trips to the minute they return home.Forget everything you know about travel insurance. At Koala, we’ve swapped out slow processes and the need for receipts for proactiveness, no exclusion and transparency.All of our products are built from scratch with the same philosophy: automating 100% of the operations while removing all the frictions of an insurance product.We believe that travellers pay for protection, not to justify their usage. That’s why we make sure that 100% of our users eligible for compensation receive their due at lightning speed.We have built to date unique innovative products with big successes as:Cancellation without justification and without reasonProactive cancelled and Delayed Flight InsuranceWe envision that travellers can travel with an absolute peace of mind knowing they will be taken care of, like no one before, in case of any needs.Already profitable, we aim to become the European reference for travel protection 🚀🧐 Why join us?You have come at the perfect time. After the first fundraising in 2020, we reached the product market fit and are ready to scale the business.Our goal: to become the European reference in travel protection. We have great ambitions and we are giving ourselves the means to achieve them on a daily basis.We are a small structure but with solid guarantees of scale-up. In a nutshell:we have protected more than 100,000 travellers in 2022 and have already protected more people annually as of March 2023we have signed 30+ distribution partners in 11 countries in Europe100% partner retention rateand above all: we are already profitableDo you want to be part of building a large-scale, ambitious but tangible project? To be part of an involved and passionate team that values excellence and sharing? Do you want to contribute your key to the building of a project so that we can raise the expectations of the travel insurance industry? Welcome to Koala.Want to know more about Koala?Company culture, teams, technical stack, jobs… Let’s go for an immersion!Visit the profileMeet Ugo, CEOMeet Alexandre, Full Stack DeveloperMeet Suvendu, Head of InsuranceJob description🎯 Your mission:As Senior product manager at Koala, your mission will be to maximize the impact of the product with partners and users to make Koala a product that delights travellers while generating revenue. The Product Manager (PM) will be in charge of researching, scoping, defining and updating our product features. The PM will work closely with the CPO and the development team.Your responsibilities:In this context and in direct collaboration with our CPO, your role will be to :Manage the delivery process from studies and functional specifications to launch in productionEnsure that the teams are aligned with this vision and can deliver the expected featuresDefine the KPIs to be impacted and the OKRs for the product teamBuild, measure and organize incoming projects and ensure their prioritizationStructure the delivery thanks to the best organizationOrganize the discovery in collaboration with the Sales and OpsEnsure the product knowledge through the company (documentation & communication)What makes the job special:You participate in the early stages of the product organisationYou work with an elite tech team who are product passionatesYou are an active stakeholder in the product strategyPreferred experience👀 You are the right person for us if:You already have a first successful experience in Product managementYou are comfortable with APIs productYou jump into complex situations, coping with many constraintsYou are ready to take on all the challenges of a company on full scale!Humour, humility, accessibility, dynamism, and ability to become a key reference at KoalaYou don’t mind talking in EnglishExperience in travel, insurance, early-stage startup growing fast or/& scaleup in a B2B model would be a plus🐨 Perks working at KoalaBenefit from optimal working conditions and a caring environment: office in Montmartre with part-time remote (3 days a week) with remote budget and bonusWe take care of you: Alan Blue (100% paid for), Swile, Navigo and many team ritualsRecruitment process📅 Recruitment processYou can get an offer in 3 weeks 🚀Fit interview: 20 minutesInterview with our CPO: 45 minCase study with 2 members of the Koala team (10 days to complete)Final session at Koala Office to meet the teamReference calls: 2 persons… So apply quickly! We look forward to meeting you!Koala guarantees equal opportunities to all candidates. Each application received is put into consideration regardless of ethnic and racial origin, opinions, beliefs, gender, sexual orientation, health or handicap.KOALACette offre vous tente ?PostulerQUESTIONS AND ANSWERS ABOUT THE OFFERIs it mandatory to send a CV?Does this position allow remote work?What type of contract is offered for this position?Is a cover letter mandatory to apply for this position?D’autres offres de Project / Product ManagementCes offres peuvent vous intéresser !OuihelpSenior Product Manager (H/F/X)CDIParisil y a 4 heuresCegedim SantéAssistant chef de projet (H/F) – Boulogne-BillancourtCDIBoulogne-Billancourtil y a 4 heuresGroupe SIIAMOA (F/H)CDIParisil y a 4 heuresBelieveJIRA Administrator (H/F)CDIParisTélétravail partiel possibleil y a 4 heuresSIEMENS MOBILITYResponsable projet logiciel h/fCDIChatillonil y a 4 heuresThalesSystems Engineering Management F/HCDIVélizy-Villacoublayil y a 4 heuresVoir toutes les offresNous construisons la nouvelle expérience au travailA PROPOSConceptQui sommes-nous ?Offres d’emploiOffres de stageCentre d’aideNOUS RENCONTRERHuman After AlldotConferencesPresseJobsTarifsCandidats : besoin d’aide ?Assistance entrepriseLA NEWSLETTER QUI FAIT LE TAFUne fois par semaine, des histoires, des jobs et des conseils dans votre boite mail.Abonnez-vous !Vous pouvez vous désabonner à tout moment. On n’est pas susceptibles, promis. Pour en savoir plus sur notre politique de protection des données, cliquez-iciDevenir clientConnexion clientMentions légalesCGUPolitique de confidentialitéCharte Welcome to the JunglePolitique cookiesGestion des cookiesFrance (FR)Axeptio consent | https://www.welcometothejungle.com/fr/companies/koala-insurance/jobs/senior-product-manager_paris?q=2cea5d1e4b84ee4ccee1674c68582dd6&o=1694222&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Koala | AccueilTrouver un jobTrouver une entrepriseMédiaDevenir clientSe connecterWho are they?Job descriptionPreferred experienceRecruitment processKOALASenior Business DeveloperCDI Salaire entre 58K € et 62K €51 Rue Lepic, Paris, 75018Télétravail partiel possibleÉducation : Non spécifiéExpérience : > 5 ansL’ENTREPRISEKoalaFinTech / InsurTech< 15 salariésLE POSTESenior Business DeveloperCDI Salaire entre 58K € et 62K €51 Rue Lepic, Paris, 75018Télétravail partiel possibleÉducation : Non spécifiéExpérience : > 5 ansPostulerWho are they?🐨 About Koala:Founded in 2018, Koalais a travel insurtech on a mission to offer peace of mind from the moment travellers book their trips to the minute they return home.Forget everything you know about travel insurance. At Koala, we’ve swapped out slow processes and the need for receipts for proactiveness, no exclusion and transparency.All of our products are built from scratch with the same philosophy: automating 100% of the operations while removing all the frictions of an insurance product.We believe that travellers pay for protection, not to justify their usage. That’s why we make sure that 100% of our users eligible for compensation receive their due at lightning speed.We have built to date unique innovative products with big successes as:Cancellation without justification and without reasonProactive Cancelled and Delayed Flight InsuranceWe envision that travellers can travel with absolute peace of mind knowing they will be taken care of, like no one before, in case of any needs.Already profitable, we aim to become the European reference for travel protection 🚀🧐 Why join us?You have come at the perfect time. After the first fundraising in 2020, we reached the product market fit and are ready to scale the business.Our goal: to become the European reference in travel protection. We have great ambitions and we are giving ourselves the means to achieve them on a daily basis.We are a small structure but with solid guarantees of scale-up. In a nutshell:we have protected more than 100,000 travellers in 2022 and have already protected more people annually as of March 2023we have signed 30+ distribution partners in 11 countries in Europe100% partner retention rateand above all: we are already profitableDo you want to be part of building a large-scale, ambitious but tangible project? To be part of an involved and passionate team that values excellence and sharing? Do you want to contribute your key to the building of a project so that we can raise the expectations of the travel insurance industry? Welcome toKoala.Want to know more about Koala?Company culture, teams, technical stack, jobs… Let’s go for an immersion!Visit the profileMeet Ugo, CEOMeet Alexandre, Full Stack DeveloperMeet Suvendu, Head of InsuranceJob description🎯 Your role:Based in Paris, you will be responsible for convincing travel agencies, carriers (airlines, ferry operators, bus operators, train operators, etc…) and other tourism companies to offer our travel protection.You will be in charge of the entire sales cycle, from sourcing to closing. As the first business developer of the team, you will work closely with the founding team to develop Koala and its sales strategy.You will deal with both short sales cycles (a few weeks) and longer cycles (several months).Your missions:Participate in the definition of the sales strategy and market penetration strategyDevelop our lead generation and closing strategyBe in charge of the entire sales cycle from sourcing to closingSet up internal sales monitoring, automation and steering toolsProvide user feedback to our product and tech teamsParticipate in the deployment of new products on the marketPreferred experience👀 What we are looking for:You are the right person for us if:You jump into complex situations, coping with many constraintsYou already have successful experiences in salesYou are ready to take on all the challenges of a company on full scale!Humour, humility, accessibility, dynamism, and ability to become a key reference at KoalaYou are comfortable with APIs productYou don’t mind talking in English (other languages would be a plus)Experience in an early-stage startup growing fast or/and scaleup would be a plus🐨 Perks working at KoalaBenefit from optimal working conditions and a caring environment: office in Montmartre with part-time remote (3 days a week) with remote budget and bonusWe take care of you: Alan Blue (100% paid for), Swile, Navigo and many team ritualsRecruitment processYou can get an offer in 3 weeks:Fit interview: 30 minutesCase study (10 days to complete)Session at Koala Office to meet the teamReference calls: 2 personsKOALACette offre vous tente ?PostulerQUESTIONS AND ANSWERS ABOUT THE OFFERIs it mandatory to send a CV?Does this position allow remote work?What type of contract is offered for this position?Is a cover letter mandatory to apply for this position?D’autres offres de Business DevelopmentCes offres peuvent vous intéresser !Work4Senior Business Developer RepresentativeCDIParisTélétravail partiel possibleil y a 1 heureVoodooInternal Studio DirectorCDIParisil y a 4 heuresDoctolibBusiness Developer – Ile de France (x/f/m)CDILevallois-Perretil y a 4 heuresHermèsCDI – Digital PMO and Change Manager (H/F)CDIParisil y a 5 heuresLittleBig ConnectionLBVN – Business DeveloperCDIParisil y a 6 heuresNaptaAccount ExecutiveCDIParisTélétravail partiel possibleil y a 11 heuresVoir toutes les offresNous construisons la nouvelle expérience au travailA PROPOSConceptQui sommes-nous ?Offres d’emploiOffres de stageCentre d’aideNOUS RENCONTRERHuman After AlldotConferencesPresseJobsTarifsCandidats : besoin d’aide ?Assistance entrepriseLA NEWSLETTER QUI FAIT LE TAFUne fois par semaine, des histoires, des jobs et des conseils dans votre boite mail.Abonnez-vous !Vous pouvez vous désabonner à tout moment. On n’est pas susceptibles, promis. Pour en savoir plus sur notre politique de protection des données, cliquez-iciDevenir clientConnexion clientMentions légalesCGUPolitique de confidentialitéCharte Welcome to the JunglePolitique cookiesGestion des cookiesFrance (FR)Axeptio consent | https://www.welcometothejungle.com/fr/companies/koala-insurance/jobs/senior-business-developer_paris?q=2cea5d1e4b84ee4ccee1674c68582dd6&o=1694167&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Rwazi | Skip to main contentLinkedInJobsDismissDismissJoin nowSign inFounding Product ManagerRwazi United States2 days ago 151 applicants See who Rwazi has hired for this roleApply Save$150k – $140k 0.1% – 0.2% EquityAbout the CompanyRwazi is a market intelligence platform that provides companies with actionable data from developing markets on who is buying what, for how much, from where, when, and why, to help them drive revenue and expand. Rwazi utilizes a network of qualified mappers spread across urban and rural areas in over 50 countries in Africa, Asia, and South America to collect data from their localities, empowering leading multinational companies around the world to better understand their consumers and grow their businesses in developing markets. Watch Rwazi’s demo day pitch video to learn more.The Rwazi team is currently operating remotely and we are open to candidates within the US.About the roleWe are seeking a founding Product Manager to help redefine and redesign our app. You will help drive the design and implementation of our next app iteration. Our goal is to produce an experience that is clean, concise, and digestible for users of all backgrounds. You will ultimately be responsible for driving impact for customers and our business by leading the ideation, technical development, and launch of innovative products, collaborating with cross-functional partners across engineering, design, ops, and product, and iterating based on customer feedback.What you’ll doDefine product metrics, objectives, and key results to guide, prioritize, and measure the success of the product strategyMaintain, monitor, and measure the performance of launched products and funnel learnings back into product development and innovationCommunicate product opportunities, challenges, plans, benefits, and results to the appropriate audience at the appropriate timeDistill the vision and strategy for the team to generate enthusiasm across cross-functional partners and executive leadershipManaging and implementing a portfolio of experiments across the conversion funnel (sign up, start the trial, convert to paid, retention, up / cross-sell)Working closely with our engineering team on great analytics and tracking stack, and evangelizing analytics across the organizationWorking closely with the marketing team to improve the user experience between the top and bottom of the conversion funnelWhat we’re seekingMust haveExcited to work in a fast-paced environmentYou have B2B experienceHave 3+ years of industry experienceHave experience with leading product roadmap decisionsHave experience with a variety of product areas (e.g., new product launch, machine learning, growth, etc.)Nice to haveExperience working with design, prototyping, wireframing, UI/UX, and user researchExperience in SalesBS or MS in computer science, engineering, or other technical degreesMotivation and flexibility to adapt in an environment where things change quicklyA Techstars portfolio company, Rwazi is an early-stage B2B SaaS startup that just raised $4M in a seed round, led by Bonfire Ventures. With an existing customer base that already includes global Fortune 500 companies, leading consulting firms, multinational government and nonprofit organizations, Rwazi’s mission is to build data infrastructure to connect developing markets to the global market. By providing access to accurate on-the-ground data, Rwazi hopes to enable consumers, employees, corporations around the world to reach their full potential.Show more Seniority levelMid-Senior levelEmployment typeFull-timeJob functionProduct ManagementIndustriesSoftware Development Referrals increase your chances of interviewing at Rwazi by 2xSee who you knowGet notified about new Product Manager jobs in United States.Sign in to create job alertSimilar jobsLicensed Insurance Advisor – Avg $120k First YearLicensed Insurance Advisor – Avg $120k First YearInsurTech AdvisorsUnited StatesJust nowSr. Account Sales Engineer – SemiconductorSr. Account Sales Engineer – Semiconductor上海森介商务咨询有限公司Shanghai, China2 minutes agoCleaning Operations Supervisor – QLD MetroCleaning Operations Supervisor – QLD MetroCity FM AustraliaBrisbane, Queensland, Australia3 minutes agoDirector, Rare Disease Epidemiology & Clinical Outcome Assessments, TherapeuticDirector, Rare Disease Epidemiology & Clinical Outcome Assessments, TherapeuticModernaCambridge, MAJust nowFinance ManagerFinance ManagerApeiron BioenergyPathum Thani, Thailand12 minutes agoVape Sales Representative in Europe and the USVape Sales Representative in Europe and the USHiredChina.com 为中国企业链接国际人才Hauts-de-France, France8 minutes agoShow more jobs like this People also viewedDeveloper Relations ManagerDeveloper Relations ManagerAlibaba CloudJakarta, Jakarta, Indonesia2 minutes agoMedia ExecutiveMedia ExecutiveZenithHong Kong, Hong Kong SAR4 minutes agoTransportation Department SupervisorTransportation Department SupervisorRightPro StaffingSt Albans, VT6 minutes agoDigital User Experience (UX) ManagerDigital User Experience (UX) ManagerRegions BankCharlotte, NC4 minutes agoLaboratory TechnicianLaboratory TechnicianFulton HoganMackay, Queensland, Australia12 minutes agoHome Infusion Nurse – Accredo – Houston, TXHome Infusion Nurse – Accredo – Houston, TXEvernorth Health ServicesHouston, TX3 minutes agoMarketing AssociateMarketing AssociateWamrus Group of CompaniesLas Piñas, National Capital Region, Philippines11 minutes agoHead of Data ManagementHead of Data ManagementQIMAEuropean UnionJust nowMatlab ExpertMatlab ExpertKPITBengaluru, Karnataka, IndiaJust nowSenior Mining Engineer – JundeeSenior Mining Engineer – JundeeNorthern Star Resources LimitedPerth, Western Australia, Australia3 minutes agoLooking for a job?Visit the Career Advice Hub to see tips on interviewing and resume writing.View Career Advice HubLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyYour California Privacy ChoicesCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/jobs/view/founding-product-manager-at-rwazi-3525720373?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Rwazi | Skip to main contentLinkedInJobsDismissDismissJoin nowSign inMarketing ManagerRwazi United States2 days ago 55 applicants See who Rwazi has hired for this roleApply SaveAbout the CompanyRwazi is a market intelligence platform that provides companies with actionable data from developing markets on who is buying what, for how much, from where, when, and why, to help them drive revenue and expand. Rwazi utilizes a network of qualified mappers spread across urban and rural areas in over 50 countries in Africa, Asia, and South America to collect data from their localities, empowering leading multinational companies around the world to better understand their consumers and grow their businesses in developing markets. Watch Rwazi’s demo day pitch video to learn more!The Rwazi team is currently operating remotely and we are open to candidates within the US.About the roleRwazi is seeking an experienced, globally minded experienced marketing generalist who is excited about the opportunity to join the company at a time of high growth and play a key role in bringing Rwazi’s products and services to market.You be working closely with the founding team and be responsible for defining our full-funnel demand generation strategy, driving pipeline and revenue growth. You will drive the business forward by identifying ways to improve conversion, engagement, and retention metrics. As an early hire, you will play a key role in shaping our product strategy and customer journey as we grow.What you’ll doLead Rwazi’s marketing efforts, focusing on full-funnel demand generation.Develop and execute multi-channel integrated marketing campaigns to generate leads and the sales pipeline.Develop customer personas and define customer journeys.Create engaging and effective content to build brand awareness and drive customer acquisition, engagement, and retention.Conduct A/B test campaigns, experiment and identify tactics to improve conversion.Continually monitor, analyze, and report campaign success to senior leadershipDefine messaging and implement go-to-market planning of new products and services.Partner and ensure operational alignment with product and sales to develop and implement marketing strategies for overall business and account-specific marketing campaigns.Own relationship with external advertising and/or marketing agencies.What we’re seeking3-4 years of experience in marketing ops.Previous experience at high-growth, fast-paced seed stage startup.Prior experience in B2B SaaS.Track record of successfully running integrated marketing campaigns that have provided revenue growth.Ability to clearly articulate demand generation strategies and convey relevant marketing tactics.Has strong ability to translate data into actionable insights.Has strong persuasive oral and written communication skills, with ability to get buy-in and resources from leadership and cross-functionally.Expert in inbound and outbound marketing tactics, digital marketing channels and tools, content creation.Is collaborative, highly motivated, organized team player with strong project management skills.Shares our vision to help people around the world reach their full potential and can inspire and motivate diverse talent.A Techstars portfolio company, Rwazi is an early-stage B2B SaaS startup that just raised M in a seed round, led by Bonfire Ventures. With an existing customer base that already includes global Fortune 500 companies, leading consulting firms, multinational government and nonprofit organizations, Rwazi’s mission is to build data infrastructure to connect developing markets to the global market. By providing access to accurate on-the-ground data, Rwazi hopes to enable consumers, employees, corporations around the world to reach their full potential.Show more Seniority levelMid-Senior levelEmployment typeFull-timeJob functionMarketingIndustriesSoftware Development Referrals increase your chances of interviewing at Rwazi by 2xSee who you knowGet notified about new Marketing Manager jobs in United States.Sign in to create job alertSimilar jobsLicensed Insurance Advisor – Avg 20k First YearLicensed Insurance Advisor – Avg 20k First YearInsurTech AdvisorsUnited StatesJust nowSr. Account Sales Engineer – SemiconductorSr. Account Sales Engineer – Semiconductor上海森介商务咨询有限公司Shanghai, China2 minutes agoCleaning Operations Supervisor – QLD MetroCleaning Operations Supervisor – QLD MetroCity FM AustraliaBrisbane, Queensland, Australia3 minutes agoFinance ManagerFinance ManagerApeiron BioenergyPathum Thani, Thailand12 minutes agoCRNA Casual Part Time – Alfred I duPont HospitalCRNA Casual Part Time – Alfred I duPont HospitalNemoursWilmington, DE2 minutes agoVape Sales Representative in Europe and the USVape Sales Representative in Europe and the USHiredChina.com 为中国企业链接国际人才Hauts-de-France, France8 minutes agoShow more jobs like this People also viewedDeveloper Relations ManagerDeveloper Relations ManagerAlibaba CloudJakarta, Jakarta, Indonesia2 minutes agoMedia ExecutiveMedia ExecutiveZenithHong Kong, Hong Kong SAR4 minutes agoTransportation Department SupervisorTransportation Department SupervisorRightPro StaffingSt Albans, VT6 minutes agoDigital User Experience (UX) ManagerDigital User Experience (UX) ManagerRegions BankCharlotte, NC4 minutes agoLaboratory TechnicianLaboratory TechnicianFulton HoganMackay, Queensland, Australia12 minutes agoHome Infusion Nurse – Accredo – Houston, TXHome Infusion Nurse – Accredo – Houston, TXEvernorth Health ServicesHouston, TX3 minutes ago(Senior) Account Manager, eLearning Sales(Senior) Account Manager, eLearning SalesHKT HomeHong Kong, Hong Kong SAR3 minutes agoMarketing AssociateMarketing AssociateWamrus Group of CompaniesLas Piñas, National Capital Region, Philippines11 minutes agoHead of Data ManagementHead of Data ManagementQIMAEuropean UnionJust nowCustomer Support SpecialistCustomer Support SpecialistCrown Equipment Pty Ltd – AustraliaBrisbane, Queensland, Australia2 minutes agoLooking for a job?Visit the Career Advice Hub to see tips on interviewing and resume writing.View Career Advice HubLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyYour California Privacy ChoicesCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/jobs/view/marketing-manager-at-rwazi-3525717810?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| backstitch | Skip to form | https://www.backstitch.io/cs/c/?cta_guid=291f15ba-2a26-4ca6-8c3d-fd2246b80bc8&signature=AAH58kFCVRJ42MTBokt9s0j-Rcioo7wXag&pageId=5610906026&placement_guid=db5fd7ab-2327-4f74-89d5-f0df5800c44b&click=fda3f4c2-e6f5-4bb4-ab0e-37b6fb1872c1&hsutk=474b1cb160ae017cd633ea5fbbc202f0&canon=https%3A%2F%2Fwww.backstitch.io%2Fcareers&portal_id=731034&redirect_url=APefjpHmoh3U-AQaxQXSvfY0eGMlj4hV4xZOUq-G1f11vNaig1NoAOl8O70gU12vVl9rdme4mv_CBpw0g2vJmtqdNv7pOHhiKc4f_61vajOqO65QoWvJ6vq56ysfN6iSuE2dLLzExu89kbT-Pt6HDdSlcGHKYnm6nQ&__hstc=139043244.474b1cb160ae017cd633ea5fbbc202f0.1679224346319.1679224346319.1679224346319.1&__hssc=139043244.1.1679224346319&__hsfp=810004322&contentType=standard-page&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Palmetto | | https://www.linkedin.com/enterprise-jobs/3511789920?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3A3f409c13-ced9-4e6b-aa72-7002e23744a2&trackingId=v3mJ1YuOfdJDHKxQjC9syg%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Bill and Melinda Gates Foundation | | https://gatesfoundation.wd1.myworkdayjobs.com/en-US/Gates/job/Seattle-WA/Senior-Officer–Strategy–Planning-and-Management–Women-s-Health-Innovations_B018705-1 |
| HomeFlow | DiscoverFind JobsFor RecruitersLog InSign UpHomeFlowHave An Outstanding Experience Buying Your First HomeShare FollowOverviewPeopleJobs1Chief Operation Officer (COO) For Exciting Real Estate Tech Startup at HomeFlow$60k – $100k • 0.1% – 5.0%SaveApplyWe are looking for a 100% results-obsessed COO to help us build a great real estate platform and positively impact the World!🏡 About Us / Company ProfileWe’re HomeFlow and we are helping consumers navigate the super stressful and time-consuming process of buying, selling, renting, or owning a home. We do that through our unbiased real estate advisors and an all-in-one collaborative platform.We want to be the place where we all go for everything related to your property. Not only buying or selling or renting. But also maintaining that property. We want people to consider us their one-stop shop for their home, where you’ll be able to see everything related to your home and hire the best professionals as well.We have launched our MVP and we have proven the model with some traction in terms of users and revenue. Now we’re looking for an entrepreneurial COO who would love to run the operations to accelerate our growth and be a critical member of the next billion-dollar unicorn. Our vision is huge, would you join us on this super exciting and fun journey?👩💻 Responsibilities / What you’ll be doing:We’re looking for a fantastic entrepreneurial Chief Operation Officer (COO) that is comfortable wearing multiple hats and jumping in wherever is needed. Some of the opportunities you’ll help us lead are:FundraisingCreating the materials that we need to raise money (pitch deck, revenue projections, and legal documents)Creating the fundraising strategy and reaching out to investorsContinuing to fundraise and lead the following seriesOperationsOversee the day-to-day operations and make sure we are compliantReview our financials and how funds are spentTeamIdentify the positions that we need to fill and create the job descriptionsMarket those specific positionsLead the interviewing and hiring processOnboard new employees -Create the company cultureStrategyIdentify new market opportunities, model them out and present them to the team -Look for opportunities to increase our productivity, efficiency, and profitability Oversee those initiatives to make sure we are on the right track🤓 Qualifications / What we’re looking forWe are looking for someone that has some or all of the following:Previous COO or executive experiencePrevious start-up experienceStrategic planning or management consulting experienceFinancial planning experienceBusiness development and/or sales experienceOthers:Strong results-orientated person, including the ability to set and handle personal goalsExcellent at presenting information through visual tools and techniquesSelf-motivated and enthusiastic to learnEnergetic, positive, and passionateStrong leadership and organizational skillsWith a can-do attitude and help out wherever is needed(Bonus) Previous startup experience (successful or unsuccessful!)(Bonus) Passionate about real estate and about empowering others to buy their own home🤑 Offer / Benefits and Perks:This is an equity-based position. We are open to someone that will be willing to come for equity only until we raise funding and that could start part-time (minimum 15 hours) and then come on board full-time (40 hours) as soon as we raise funding.We are a remote-first environment that supports flexible working hours and understands work-life balance.If you’re thinking: “This is totally me!” then be sure to apply below. We can’t wait to meet you!Apply nowLocationRemote • New York City • BrooklynJob typeFull TimeVisa sponsorshipNot AvailableHires remotelyEverywhereRemote work policyRemote onlyCollaboration hours9:00 AM – 6:00 PMExperience5+ yearsSkillsSoftware DevelopmentMobile DevelopmentFull Stack DevelopmentChief Operating OfficerApplication DevelopmentHiring contactLaura MorenoFounderHomeFlow at a glanceHave An Outstanding Experience Buying Your First HomeHomeFlow focuses on Real Estate, Real Estate Technology, Education Technology, and Residential Real Estate. Their company has offices in New York City and Brooklyn. They have a small team that’s between 1-10 employees.You can view their website at https://tryhomeflow.com/ or find them on Twitter, Facebook, and LinkedIn.Similar jobs to Chief Operation Officer (COO) For Exciting Real Estate Tech Startup at HomeFlowEmbarkSupporting schools with choosing their students and helping students apply for federal aidChief Operating Officer (COO)View more jobs at EmbarkFoundLostChallenging expeditions with a purpose to the frontiers of our planetCOO/Operations DirectorView more jobs at FoundLostPaper Plane EntertainmentDeveloping high quality contentPaper Plane New York Based Management TeamView more jobs at Paper Plane Entertainmentailaaila is a wellness brand for the active woman who sees fitness as a lifestyleHead of OperationsView more jobs at ailaBrik + ClikOmnichannel Retail MarketplaceV.P. Retail Growth and Brand PartnershipsView more jobs at Brik + ClikAvela EducationUniversal, Equitable Application for Educational OpportunityChief of Staff / BizOps ManagerView more jobs at Avela EducationMott & BowWe make the jeans you’ll reach for every timeChief Operating OfficerView more jobs at Mott & BowMmmlyPurposeful ingredients + taste = cookies reimaginedCo-Founder/Operations ManagerView more jobs at MmmlyMotorEnvyLuxury Vehicle SubscriptionChief Operating Officer/PresidentView more jobs at MotorEnvyNeuroSilicabrain-computer interface hardware, deep brain stimulation, artificial retinaCapital raising / Chief Operating OfficerView more jobs at NeuroSilicaABOUT HOMEFLOWWebsitetryhomeflow.comLocationsNew York CityBrooklynCompany size1-10 peopleMarketsReal EstateReal Estate TechnologyEducation TechnologyResidential Real EstateJOBS AT HOMEFLOWManagement1 jobJobsFeatured ListsRemote JobsJobs by LocationJobs by RoleJobs by Role & LocationFor CandidatesOverviewStartup JobsWeb3 JobsFeaturedRemoteTech StartupsSalary CalculatorFor RecruitersOverviewRecruit ProCuratedRemoteHire DevelopersPricingCompanyAboutHelpBlogTerms & RisksPrivacy & CookiesCopyright © 2023 Wellfound (formerly AngelList Talent). All rights reserved.Browse by: Jobs, Remote Jobs | https://angel.co/company/tryhomeflow/jobs/2477470-chief-operation-officer-coo-for-exciting-real-estate-tech-startup?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Follow Up Boss: Senior Full Stack EngineerHeadquarters: Remote URL: https://careers.followupboss.comAbout the jobAs a Senior Full Stack Engineer at Follow Up Boss, you’ll build fully-fledged platforms using a range of different technologies. You’ll be involved in the entire product development lifecycle including the design, development, deployment and maintenance of new and existing features. You’ll write clean and functional code on the front- and back-end. You’ll collaborate closely with our engineering team to ensure system consistency and to create a great user experience. You’ll write reusable and maintainable code that is secure and scales well. You’ll help ensure code quality with automated and functional testing along with peer review. Ultimately, your work will have direct impact on the stability and user experience of our products.Why would you want to work here?We’re a bootstrapped, profitable company started back in April of 2011. We’re a young, ambitious company who only answers to our customers and we don’t just claim to be customer-centric – we live it. We’re fully remote and have been since day 1. Here’s a few more reason’s we think you’ll love working here – and be sure to check out our video on how we work:Opportunity to have a big impact on our growth and your careerNo red tape or pointless meetingsCompetitive base salary – top 10% in US; for this position the salary range is $166K – $180KStrong benefit package including a 401k with 6% match, health/dental/vision insurance for you and our family, funding for continuing education, paid parental leave, kindle + unlimited books, home office setup, company meetups, and 20 PTO + 10 sick daysSolve challenging technical problems and put your skills to the test every day. We’ve processed over a billion emails; per month we send nearly 3 million text messages and handle 700k+ minutes of call time for tens of thousands of active customers.See a direct impact of your work and value you created for customers.Provide direct input on technical and non-technical decisions. Your opinion matters.Learn more about our company hereThis role is for you if…You would describe yourself as patient, empathetic and having a good sense of humor.You’re independent, self-motivated and can stay efficient and productive without someone looking over your shoulder all day longYou have superb written and verbal skills (with a professional yet fun demeanor)You are based in the United States (or similar time zone) You are happy to have direct communication with customers (we are customer driven).Your qualifications include:Self motivated and proactive mindset.Remote work experience is required.Based in the USA, with a quiet home office with fast internet.At least 5 years of experience in web development.Expertise in front end technologies, we use React, JavaScript, CSS.Expertise in back end technologies, we use PHP, Aurora MySQL, Postgres, Redis, to name a few.Strong understanding of RDBMS and SQL. Proficient understanding of Linux.Exceptional time management skills. Attention to detail and commitment to quality. Security conscious. Pragmatic decision making.Your responsibilities will include:Develop and improve our application.Help fix issues with the application.Mentor other team members.30 Day TargetsBecome familiar with our product and codebase. Pair with fellow engineers to gain knowledge about the system and how we work. Improve the new hire onboarding process, by being a part of it. Help address priority bugs60 Day TargetsImplement improvements for new and existing third party integrations.Implement new product features and improvements that deliver value to our customers.Improve how our product supports customers with larger teams.90 Day TargetsImplement improvements to the security of our app and customer’s data.Assist in architecture improvements of critical product featuresAssist in performance improvements to our API.Core Engineering ValuesTeamworkCommunicationCode QualityFocus and PrioritizationCustomer DrivenLeadership Qualities Apply for the jobDo you want to join our team as our new Senior Full Stack Engineer? Then we’d love to hear about you!To apply: https://weworkremotely.com/remote-jobs/follow-up-boss-senior-full-stack-engineer-3 | https://weworkremotely.com/remote-jobs/follow-up-boss-senior-full-stack-engineer-3 |
| Driver | | https://drivertechnologies.com/job-details/rec65OBVkQEHxpr4m?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Goally | Skip to main contentLinkedInJobsDismissDismissJoin nowSign inSenior Backend DeveloperGoally Lahore, Punjab, Pakistan2 days ago Be among the first 25 applicants See who Goally has hired for this roleApplySaveDirect message the job poster from GoallyAyesha Mujib|| Hiring Senior React Native Dev | Talent Acquisition Specialist | Technical Recruiter | Head Hunter | Human Resources Manager ||Goally Lahore – Senior Backend Developer Who are we:Goally is a Denver Colorado USA based software company with a mission to ease the lives of families with special needs kids. We make software and content that families can use at home. We’ve been in business since 2017 and have helped thousands of kids get the therapy they deserve. Learn more about our product at www.getgoally.com. We have an office in Lahore Pakistan where we are building an elite engineering team. ExperienceMore than 4 yearsThe JobWork with our product design team to understand backend product requirementsDevelop backend APIs for adding, retrieving, searching, updating, and deleting the listed entriesWe code in typescript with nest.js framework, express graphQLDesign MongoDB database hosted on MongoDB Atlas service with Redis and use Socket.ioDesign and write unit tests that insure code quality throughout our platformCompensation:This role pays 250k to 400k PKR, depending on experience and skills.We are also offering health benefit.Your Day to DayOur office timings are 10:00 am to 7:00 pm. We are located at Al Hafeez Executive – 30 Firdous Mkt Rd, Block G Gulberg III, Lahore, Punjab, Pakistan.Show more Employment typeFull-time Referrals increase your chances of interviewing at Goally by 2xSee who you knowGet notified about new Senior Software Engineer jobs in Lahore, Punjab, Pakistan.Sign in to create job alertSimilar jobsSr. Account Sales Engineer – SemiconductorSr. Account Sales Engineer – Semiconductor上海森介商务咨询有限公司Shanghai, China2 minutes agoMedical DirectorMedical DirectorNeuroglee TherapeuticsBoston, MA8 minutes agoLicensed Insurance Agent – Avg $120k First YearLicensed Insurance Agent – Avg $120k First YearInsurTech AdvisorsUnited States1 minute agoCleaning Operations Supervisor – QLD MetroCleaning Operations Supervisor – QLD MetroCity FM AustraliaBrisbane, Queensland, Australia3 minutes agoFinance ManagerFinance ManagerApeiron BioenergyPathum Thani, Thailand11 minutes agoVape Sales Representative in Europe and the USVape Sales Representative in Europe and the USHiredChina.com 为中国企业链接国际人才Hauts-de-France, France8 minutes agoShow more jobs like this People also viewedDeveloper Relations ManagerDeveloper Relations ManagerAlibaba CloudJakarta, Jakarta, Indonesia2 minutes agoMedia ExecutiveMedia ExecutiveZenithHong Kong, Hong Kong SAR4 minutes agoTransportation Department SupervisorTransportation Department SupervisorRightPro StaffingSt Albans, VT6 minutes agoDigital User Experience (UX) ManagerDigital User Experience (UX) ManagerRegions BankCharlotte, NC4 minutes agoBenefits Analyst (Manager)Benefits Analyst (Manager)ConnectedGroupHong Kong, Hong Kong SARJust nowLaboratory TechnicianLaboratory TechnicianFulton HoganMackay, Queensland, Australia12 minutes agoHome Infusion Nurse – Accredo – Houston, TXHome Infusion Nurse – Accredo – Houston, TXEvernorth Health ServicesHouston, TX2 minutes agoSales DirectorSales DirectorModa | Ecommerce GrowthBengaluru, Karnataka, India1 minute agoHuman Resources OfficerHuman Resources OfficerAusGroup – AGC | MASPerth, Western Australia, Australia13 minutes agoMarketing AssociateMarketing AssociateWamrus Group of CompaniesLas Piñas, National Capital Region, Philippines11 minutes agoLooking for a job?Visit the Career Advice Hub to see tips on interviewing and resume writing.View Career Advice HubLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyYour California Privacy ChoicesCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://pk.linkedin.com/jobs/view/senior-backend-developer-at-goally-3528566103?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Stockly | AccueilTrouver un jobTrouver une entrepriseMédiaDevenir clientSe connecterWho are they?Job descriptionPreferred experienceRecruitment processSTOCKLYBusiness Developer – Alternance – ParisAlternance (12 mois)Début : 26 mars 2023Salaire entre 1,3K € et 1,5K € / mois8, Rue du Sentier, Paris, 75002Télétravail partiel possibleÉducation : Bac +4Expérience : Non spécifiéL’ENTREPRISEStocklyLogiciels, E-commerceEntre 50 et 250 salariésLE POSTEBusiness Developer – Alternance – ParisAlternance (12 mois)Début : 26 mars 2023Salaire entre 1,3K € et 1,5K € / mois8, Rue du Sentier, Paris, 75002Télétravail partiel possibleÉducation : Bac +4Expérience : Non spécifiéPostulerWho are they?🔭 Stockly is a tech-retail company solving the supply/demand mismatch in e-commerce.With our technology, we connect in real-time e-commerce websites in need for stock with the inventory of hundreds of other retailers who have the same products available, and who can fulfill the order on their behalf.E-retailers can sell products they don’t own, while others can gain additional sales, in a seamless experience for the end-consumer.🏆 Our mission is to create the world’s 1st globally shared inventory for retail. To better understand what we do, check out our french pitch at BFMTV (🇫🇷), or our English pitch at Techstars (🇬🇧).🚀 We’ve already raised $20M+ with European top-tier investors among which Daphni, Eurazeo and Raise. Our proprietary technology, coded in-house from scratch, is already live across Europe with 450+ e-retailers, we grow x4 each year and won’t stop there.Want to know more about Stockly?Company culture, jobs… Let’s go for an immersion!Visit the profileRencontrez Eliott, CEORencontrez Oscar, CTORencontrez Camille, Software EngineerJob description🔎 In a nutshell, what we look for?We are looking for a smart and talented team-member to join our Business team. This team is already composed of 6 amazing members (e.g. Matthieu, Ilayda, Yann)… You will also be directly working with our CEO EliottWe are looking for an intern to start as soon as possible.🏈 About your future TeamThe Business team is in charge of signing new partners. The team has a pivotal role in Stockly’s growth and has already successfully signed hundreds of suppliers.Over the past years, typical missions of the team would include:Reach out to (e)retailers all over Europe from a very curative brand to a distributor generating +1bn in salesUnderstand customer needs and buying cycle to gather key prospect information, generate interest and bring in successful customersQualification, contacts, demos & closing from inbound & outbound leads. You are always the first touchpoint with the client until the partner is signed!Negotiate the best deals for Stockly and our partners. Always aim for a win-win situation🧑🚀 About your future job🎯 Objectives: what could be examples of your first quarter objectives?Objective: Close a dozen of contracts with partnersPerformance measurement: number of qualified leads, closings and contractsTasks: manage the deal from A to Z (finding the partner, contacting him, convincing, sending contract…🥊 Challenges: what are the challenges / problems you will solve?Deal with a lot of complexity specific (or not) to some partners, in an ever-expanding technical environmentFind the right retailers to target, make first contact with themLead calls to understand how they work, pitch them the deal you’d like to offer themLead the negotiations with the future retailers, be tenacious to demonstrate the value of Stockly for themPrepare the contracts and close the dealManage side-projects to improve the overall team’s performancesDeal with a wide range of targets and working styles (e.g. large and small companies, many different countries and cultures…)📚 Learnings: what will you learn?Understand how Stockly works internally to add even more value to the companyHow e-commerce works, the business models, the technology used, the problems the retailers encounter every dayHow to pitch to a very large variety of players (we work with retailers all over European Union, with very various cultures, languages and backgrounds)How to close a clean business deal from A to ZHow to use the sharpest toolsHow to create the best processes to keep the organization super efficient and to help you reach your objectivesWork with an amazing bizdev team, directly led by the CEOUnderstand how Stockly works internally to add even more value to the company🔭 Projection: At Stockly, you make the collective grow and we want to make you grow as well, what would be the next moves for you with us?Possibility to have a lot of weight over how we do things – we are still a super young companyIf your internship goes well for both you and Stockly, why not join us? We are growing fast, there is space for every amazing people!💝 About your future benefitsCompetitive packages: for this position, package range is typically 1300-1500€ depending on the profile (e.g. basic knowledge to expert). We have a well defined and objective salary grid that is based on both skills level and scarcity of profiles 💸Meal vouchers by Swile 🍽️50% reimbursement of your Navigo Pass 🚋A central and amazing working environment in le Sentier (Paris) 💼Flexible and remote-friendly policy 🏡Possibility to take a few paid days-off to be discussed with Team Leader 🏄Stockly dinners together every other Thursday 🍻Stockly breafkasts together every other Friday 🥐Coffee, tea and fruits available everyday 🍇Climbing & football team 🧗⚙️ About how we workEvery team has a daily meeting to align on priorities and solve issues ⇒ You won’t be left alone!Every Monday, we have a global weekly meeting where every team shares what they are working on and what they will do for the coming week ⇒ You will have visibility on the whole company!Every quarter, we have our OKR meeting (Objectives, Key Results) where each team shows the results of the previous quarter and the objectives of the following one ⇒ You will see the company grow and your own role inside of it!During all these meetings everyone can challenge each other and all questions are more than welcome ⇒ Transparency is one of our key values, and we are always open to new ideas!Preferred experienceWe are looking for a great balance between hard skills and soft skills !🧑💻 Hard skillsLogic: you love logical problems and are strong in reasoning 📐Data drivenEducation: from a business background **🎓Languages: Fluent in English 🇬🇧 Spanish is a plus but not mandatory 🇪🇸🤝 Soft skillsSmart, curious and a fast learner: you don’t know everything, but you can learn anythingTenacious: you never give up even when it is complexAmbitious: you are ready to reshape the global e-commerce landscape with usNice, humble and friendly: you love learning from others and humbly sharing knowledge with themAutonomous and hard working: you know how to manage your tasks independently and ask for help when neededGood at first contact and patient👊 So if you see yourself in the shoes of a Stockler – Apply now! 👊Recruitment process🏎️ Our process goes fast, we are reactive and we adapt to your availabilities, we can typically go through the whole process in 2-3 weeks:20min video-call with a member of our Talent Acquisition team – To understand your background and motivations, and reply to your questions30min entry-test to be sent by email – You will have some time to do it at home1-hour face to face(or remote) interview with our CEO Eliott – To have a deeper discussion🎉 Final offer 🎉🏡 Part of the process can be done remotely if you have constraintsSTOCKLYCette offre vous tente ?PostulerQUESTIONS AND ANSWERS ABOUT THE OFFERIs it mandatory to send a CV?Does this position allow remote work?What type of contract is offered for this position?Is a cover letter mandatory to apply for this position?What is the start date of the contract?D’autres offres de Business DevelopmentCes offres peuvent vous intéresser !Picard SurgelésChargé(e) d’Affaires Règlementaires en Alternance (H/F)AlternanceIssy-Les-MoulineauxhierThigaGrowth Marketing (Alternance)AlternanceParisTélétravail partiel possibleavant-hierAmplifonAlternance – Chef de projet et communication – Développement (H/F)AlternanceParisTélétravail partiel possibleavant-hierVeoliaAlternance – Business development Assistant, Life Sciences market – H/FAlternanceAubervilliersavant-hierLegalPlacePartnerships Project Manager- AlternanceAlternanceParisil y a 3 joursMagnétisBusiness DeveloperAlternanceCourbevoieTélétravail partiel possibleil y a 3 joursVoir toutes les offresNous construisons la nouvelle expérience au travailA PROPOSConceptQui sommes-nous ?Offres d’emploiOffres de stageCentre d’aideNOUS RENCONTRERHuman After AlldotConferencesPresseJobsTarifsCandidats : besoin d’aide ?Assistance entrepriseLA NEWSLETTER QUI FAIT LE TAFUne fois par semaine, des histoires, des jobs et des conseils dans votre boite mail.Abonnez-vous !Vous pouvez vous désabonner à tout moment. On n’est pas susceptibles, promis. Pour en savoir plus sur notre politique de protection des données, cliquez-iciDevenir clientConnexion clientMentions légalesCGUPolitique de confidentialitéCharte Welcome to the JunglePolitique cookiesGestion des cookiesFrance (FR)Axeptio consent | https://www.welcometothejungle.com/fr/companies/stockly/jobs/business-developer-alternance_paris?q=0696b72f8ef0a95bcb5ac4a8c509eff6&o=1491358&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Stockly | AccueilTrouver un jobTrouver une entrepriseMédiaDevenir clientSe connecterWho are they?Job descriptionPreferred experienceRecruitment processSTOCKLYStrategic Partnership Manager – CDI – ParisCDI Début : 2 avril 2023Salaire entre 50K € et 70K €8, Rue du Sentier, Paris, 75002Télétravail ponctuel autoriséÉducation : Bac +5 / MasterExpérience : > 2 ansL’ENTREPRISEStocklyLogiciels, E-commerceEntre 50 et 250 salariésLE POSTEStrategic Partnership Manager – CDI – ParisCDI Début : 2 avril 2023Salaire entre 50K € et 70K €8, Rue du Sentier, Paris, 75002Télétravail ponctuel autoriséÉducation : Bac +5 / MasterExpérience : > 2 ansPostulerWho are they?🔭 Stockly is a tech-retail company solving the supply/demand mismatch in e-commerce.With our technology, we connect in real-time e-commerce websites in need for stock with the inventory of hundreds of other retailers who have the same products available, and who can fulfill the order on their behalf.E-retailers can sell products they don’t own, while others can gain additional sales, in a seamless experience for the end-consumer.🏆 Our mission is to create the world’s 1st globally shared inventory for retail. To better understand what we do, check out our french pitch at BFMTV (🇫🇷), or our English pitch at Techstars (🇬🇧).🚀 We’ve already raised $20M+ with European top-tier investors among which Daphni, Eurazeo and Raise. Our proprietary technology, coded in-house from scratch, is already live across Europe with 450+ e-retailers, we grow x4 each year and won’t stop there.Want to know more about Stockly?Company culture, jobs… Let’s go for an immersion!Visit the profileRencontrez Eliott, CEORencontrez Oscar, CTORencontrez Camille, Software EngineerJob descriptionThe Position🔎 In a nutshell, what we look for?We are looking for a smart and talented full-time team-member to join our amazing team members. (e.g. Ilayda, Anna). You will be directly working with our Head of Network & Growth Pierre. Due to our strong growth, this number is likely to increase quite rapidly.We are looking for a CDI to start as soon as possible.🏈 About your future TeamThe Business team is in charge of maintaining the relationship with our partners. The team has a pivotal role in Stockly’s growth and has already successfully satisfied hundreds of suppliers and e-retaillers.Over the past years typical missions of the team would include:Reach more than 300 partners in the Stockly networkSupervising the integration process for new partners, internally and with the partnerIdentifying new opportunities within the network of either increasing turnover or reducing the number of Operations actions per € of Gross Margin ValueMonitoring our pool of supply and ensuring a quality of service adaptable to any partnerDetect, analyze and solve all abnormal behaviors, errors or mistakes from suppliers🧑🚀 About your future job🎯 Objectives: what could be examples of your first quarters objectives?Objective: Ensure 100% retention rate with existing partnersPerformance measurement: number of partners that churnTasks: maintain regular contacts, respond to questions and worries from partnersObjective: Boost Gross Merchandising Value and MarginPerformance measurement: Volume, value of transactions through Stockly network & margin levelsTasks: Perform datachecks to analyze performance and take actions with partners to implement improvements🥊 Challenges: what are the challenges / problems you will solve?Deal with a lot of complexity specific (or not) to some partners, in an ever-expanding technical environmentLead negotiations with the retailers, be tenacious to demonstrate the value of Stockly for themManage side-projects to improve the overall team’s performances📚 Learnings: what will you learn?Understand how Stockly works internally to add even more value to the companyHow e-commerce works, business models, used technology, problems the retailers encounter every dayHow to pitch to a very large variety of players (we work with retailers all over European Union, with very various cultures, languages and backgrounds)How to use the best processes to keep the organization super efficient and to help you reach your objectives🔭 Projection: At Stockly, you make the collective grow and we want to make you grow as well, what would be the next moves for you with us?Possibility to have a lot of weight over how we do things – we are still a young companyMore and more autonomy on your deals or negotiations overtimeMore and more complex deals overtimeImproving processes to help scale the teamLeading relationships with business indirect partnersTraining newcomers💝 About your future benefitsCompetitive packages: for this position, package range is typically 45-60k€ depending on the profile (e.g. basic knowledge to expert). We have a well defined and objective salary grid that is based on both skills level and scarcity of profiles 💸BSPCE for everyone (for permanent contracts) 🚀Health insurance provided by Alan 💊Meal vouchers by Swile 🍽️50% reimbursement of your Navigo Pass 🚋A central and amazing working environment in le Sentier (Paris) 💼Flexible and remote-friendly policy 🏡Stockly dinners together every other Thursday 🍻Stockly breafkasts together every other Friday 🥐Coffee, tea and fruits available everyday 🍇Climbing & football team 🧗⚙️ About how we workEvery team has a daily meeting to align on priorities and solve issues ⇒ You won’t be left alone!Every Monday we have a global weekly meeting where every team shares what they are working on and what they will do for the coming week ⇒ You will have visibility on the whole company!Every quarter we have our OKR meeting (Objectives, Key Results) where each team shows the results of the previous quarter and the objectives of the following one ⇒ You will see the company grow and your own role inside of it!During all these meetings everyone can challenge each other and all questions are more than welcome ⇒ Transparency is one of our key values, and we are always open to new ideas!Preferred experienceWe are looking for a great balance between hard skills and soft skills !🧑 💻 Hard skillsLogic: you love logical problems and are strong in reasoning 📐Data drivenEducation: from a business background 🎓Languages: Fluent in English 🇬🇧 Spanish is a plus but not mandatory 🇪🇸🤝 Soft skillsSmart, curious and a fast learner: you don’t know everything, but you can learn anythingTenacious: you never give up even when it is complexAmbitious: you are ready to reshape the global e-commerce landscape with usNice, humble and friendly: you love learning from others and humbly sharing knowledge with themAutonomous and hard working: you know how to manage your tasks independently and ask for help when neededGood at first contact and patient👊 So if you see yourself in the shoes of a Stockler – don’t hesitate! 👊Recruitment process🏎️ Our process goes fast, we are reactive and we adapt to your availabilities, we can typically go through the whole process in 2-3 weeks:30min video-call with a member of our Talent Acquisition team – To understand your background and motivations, and reply to your questions30minentry-test to be sent by email – You will have some time to do it at home1-hour face to face(or remote) interview with our Head of Network, Pierre, or Eliott, our CEO- To have a deeper discussionHalf-a-day immersion at Stockly to meet all the team (on site or in remote) – Meet the team, put yourself in the shoes of a Stockler, ask all your questionsReference checks – Quick reference calls with contacts you would provide us🎉 Final offer 🎉🏡 Part of the process can be done remotely if you have constraintsSTOCKLYCette offre vous tente ?PostulerQUESTIONS AND ANSWERS ABOUT THE OFFERIs it mandatory to send a CV?Does this position allow remote work?What type of contract is offered for this position?Is a cover letter mandatory to apply for this position?What is the start date of the contract?D’autres offres de Account ManagementCes offres peuvent vous intéresser !LittleBig Connection[MRU] [LB] [Business Account Specialist] [UDC] – 2023CDIParisil y a 6 heuresShareGroopCustomer Success Manager – CDICDIParisTélétravail partiel possibleil y a 17 heuresSimpléboCustomer Success Manager (H/F)CDIParisTélétravail partiel possibleil y a 19 heuresPublicis FranceClient Development Associate/ Advertising Account Manager (H/F)CDIParishierStockly Déjà vuKey Account Manager – CDI – ParisCDIParisavant-hierBack MarketAccount ManagerCDIParisavant-hierVoir toutes les offresNous construisons la nouvelle expérience au travailA PROPOSConceptQui sommes-nous ?Offres d’emploiOffres de stageCentre d’aideNOUS RENCONTRERHuman After AlldotConferencesPresseJobsTarifsCandidats : besoin d’aide ?Assistance entrepriseLA NEWSLETTER QUI FAIT LE TAFUne fois par semaine, des histoires, des jobs et des conseils dans votre boite mail.Abonnez-vous !Vous pouvez vous désabonner à tout moment. On n’est pas susceptibles, promis. Pour en savoir plus sur notre politique de protection des données, cliquez-iciDevenir clientConnexion clientMentions légalesCGUPolitique de confidentialitéCharte Welcome to the JunglePolitique cookiesGestion des cookiesFrance (FR)Axeptio consent | https://www.welcometothejungle.com/fr/companies/stockly/jobs/strategic-partnership-manager_paris?q=0696b72f8ef0a95bcb5ac4a8c509eff6&o=1463527&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Stockly | AccueilTrouver un jobTrouver une entrepriseMédiaDevenir clientSe connecterQui sont-ils ?Descriptif du posteProfil recherchéDéroulement des entretiensSTOCKLYSales Associate – CDI – ParisCDI Début : 19 mars 2023Salaire entre 45K € et 60K €8, Rue du Sentier, Paris, 75002Éducation : Bac +5 / MasterExpérience : Non spécifiéL’ENTREPRISEStocklyLogiciels, E-commerceEntre 50 et 250 salariésLE POSTESales Associate – CDI – ParisCDI Début : 19 mars 2023Salaire entre 45K € et 60K €8, Rue du Sentier, Paris, 75002Éducation : Bac +5 / MasterExpérience : Non spécifiéPostulerQui sont-ils ?🔭 Stockly est une entreprise de retail-tech, qui cherche à résoudre les ruptures de stock dans le e-commerce.👨💻 Sa technologie connecte en temps réel les sites de e-commerce qui ont besoin de stock avec l’inventaire de centaines d’autres détaillants qui ont les mêmes produits disponibles, et qui peuvent remplir la commande en leur nom.🚀 Stockly a déjà levé plus de 20 millions d’euros auprès d’investisseurs européens de premier plan, dont Daphni, Eurazeo et Raise.Envie d’en savoir plus sur Stockly ?Culture d’entreprise, offres d’emplois… C’est parti pour l’immersion !Visiter le profilRencontrez Eliott, CEORencontrez Oscar, CTORencontrez Camille, Software EngineerDescriptif du posteThe Position🔎 In a nutshell, what are we looking for?We are looking for a smart and talented full-time team-member to join our Business team. This team is already composed of 6 amazing members (e.g. Matthieu, Ilayda, Yann). You will also be directly working with our CEO EliottDue to our strong growth, this number is likely to increase quite rapidly.We are looking for a CDI to start as soon as possible.🏈 About your future TeamThe Business team is in charge of signing new partners. The team has a pivotal role in Stockly’s growth and has already successfully signed hundreds of suppliers.Over the past years typical missions of the team would include:Reach out to hundreds of (e)retailers all over Europe from a very curative brand to a distributor generating +1bn in salesUnderstand customer needs and buying cycle to gather key prospect information, generate interest and bring in successful customersQualification, contacts, demos & closing from inbound & outbound leads. You are always the first touchpoint with the client until the partner is signed!Negotiate the best deals for Stockly and our partners. Always aim for a win-win situation🧑🚀 About your future job🎯 Objectives: what could be examples of your first quarter objectives?Objective: Close a contract with 15 new retailers and 5 new brandsPerformance measurement: number of closingsTasks: manage the deal from A to Z (finding the partner, contacting him, convincing, sending contract…🥊 Challenges: what are the challenges / problems you will solve?Deal with a lot of complexity specific (or not) to some partners, in an ever-expanding technical environmentFind the right retailers to target, make first contact with themLead calls to understand how they work, pitch them the deal you’d like to offer themLead the negotiations with the future retailers, be tenacious to demonstrate the value of Stockly for themPrepare the contracts and close the dealManage side-projects to improve the overall team’s performancesDeal with a wide range of targets and working styles (e.g. large and small companies, many different countries and cultures…)📚 Learnings: what will you learn?Understand how Stockly works internally to add even more value to the companyHow e-commerce works, the business models, the technology used, the problems the retailers encounter every dayHow to pitch to a very large variety of players (we work with retailers all over European Union, with very various cultures, languages and backgrounds)How to close a clean business deal from A to ZHow to use the sharpest toolsHow to create the best processes to keep the organization super efficient and to help you reach your objectives🔭 Projection: At Stockly, you make the collective grow and we want to make you grow as well, what would be the next moves for you with us?Possibility to have a lot of weight over how we do things – we are still a young companyMore and more autonomy on your deals or negotiations overtimeMore and more complex deals overtimeBuilding the right processes to help scale the teamTraining newcomers💝 About your future benefitsCompetitive packages: for this position, package range is typically 45-60k€ depending on the profile (e.g. basic knowledge to expert). We have a well defined and objective salary grid that is based on both skills level and scarcity of profiles 💸BSPCE 🚀Health insurance provided by Alan 💊Meal vouchers by Swile 🍽️50% reimbursement of your Navigo Pass 🚋A central and amazing working environment in le Sentier* (Paris) 💼Flexible and remote-friendly policy 🏡Stockly dinners together every other Thursday 🍻Stockly breafkasts together every other Friday 🥐Coffee, tea and fruits available everyday 🍇Climbing & football team 🧗⚙️ About how we workEvery team has a daily meeting to align on priorities and solve issues ⇒ You won’t be left alone!Every Monday we have a global weekly meeting where every team shares what they are working on and what they will do for the coming week ⇒ You will have visibility on the whole company!Every quarter we have our OKR meeting (Objectives, Key Results) where each team shows the results of the previous quarter and the objectives of the following one ⇒ You will see the company grow and your own role inside of it!During all these meetings everyone can challenge each other and all questions are more than welcome ⇒ Transparency is one of our key values, and we are always open to new ideas!Profil recherchéWe are looking for a great balance between hard skills and soft skills !🧑💻 Hard skillsLogic: you love logical problems and are strong in reasoning 📐Data drivenEducation: from a business background **🎓Languages: Fluent in English and 🇬🇧 Spanish is a plus but not mandatory 🇪🇸🤝 Soft skillsSmart, curious and a fast learner: you don’t know everything, but you can learn anythingTenacious: you never give up even when it is complexAmbitious: you are ready to reshape the global e-commerce landscape with usNice, humble and friendly: you love learning from others and humbly sharing knowledge with themAutonomous and hard working: you know how to manage your tasks independently and ask for help when neededGood at first contact and patient👊 So if you see yourself in the shoes of a Stockler – don’t hesitate! 👊Déroulement des entretiensRecruitment process🏎️ Our process goes fast, we are reactive and we adapt to your availabilities, we can typically go through the whole process in 2-3 weeks:20min video-call with a member of our Talent Acquisition team – To understand your background and motivations, and reply to your questions30min entry-test to be sent by email – You will have some time to do it at home1-hour face to face(or remote) interview with our Head of Network Pierre or Eliott our CEO- To have a deeper discussionHalf-a-day immersion at Stockly to meet all the team (on site or in remote) – Meet the team, put yourself in the shoes of a Stockler, ask all your questionsReference checks – Quick reference calls with contacts you would provide us🎉 Final offer 🎉🏡 Part of the process can be done remotely if you have constraintsSTOCKLYCette offre vous tente ?PostulerQUESTIONS ET RÉPONSES SUR L’OFFREL’envoi d’un CV est-il obligatoire pour postuler à cette offre ?Le télétravail est-il possible pour ce poste ?Quel est le type de contrat pour ce poste ?Une lettre de motivation est-elle obligatoire pour postuler à cette offre ?Quelle est la date de début du contrat?D’autres offres de CommercialCes offres peuvent vous intéresser !AlgoliaPartner Account Manager – GermanyCDIParisTélétravail total possibleil y a 4 heuresJCDecauxChef de Publicité IDF (H/F)CDIGennevilliersil y a 4 heuresNexityConseiller Immobilier H/F NGIPCDIParisil y a 4 heuresFinance ActiveReal Estate Sales ExecutiveCDIParisil y a 4 heuresThalesIngénieur commercial Naval (H/F)CDIGennevilliersil y a 4 heuresProsolResponsable adjoint – Produits de la mer (H/F)CDIRueil-Malmaisonil y a 5 heuresVoir toutes les offresNous construisons la nouvelle expérience au travailA PROPOSConceptQui sommes-nous ?Offres d’emploiOffres de stageCentre d’aideNOUS RENCONTRERHuman After AlldotConferencesPresseJobsTarifsCandidats : besoin d’aide ?Assistance entrepriseLA NEWSLETTER QUI FAIT LE TAFUne fois par semaine, des histoires, des jobs et des conseils dans votre boite mail.Abonnez-vous !Vous pouvez vous désabonner à tout moment. On n’est pas susceptibles, promis. Pour en savoir plus sur notre politique de protection des données, cliquez-iciDevenir clientConnexion clientMentions légalesCGUPolitique de confidentialitéCharte Welcome to the JunglePolitique cookiesGestion des cookiesFrance (FR)Axeptio consent | https://www.welcometothejungle.com/fr/companies/stockly/jobs/cdi-sales-associate_paris?q=0696b72f8ef0a95bcb5ac4a8c509eff6&o=1317847&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Stockly | AccueilTrouver un jobTrouver une entrepriseMédiaDevenir clientSe connecterWho are they?Job descriptionPreferred experienceRecruitment processSTOCKLYBusiness Developer (Full Cycle) – CDI – ParisCDI Début : 19 mars 2023Salaire entre 45K € et 60K €8, Rue du Sentier, Paris, 75002Éducation : Bac +5 / MasterExpérience : Non spécifiéL’ENTREPRISEStocklyLogiciels, E-commerceEntre 50 et 250 salariésLE POSTEBusiness Developer (Full Cycle) – CDI – ParisCDI Début : 19 mars 2023Salaire entre 45K € et 60K €8, Rue du Sentier, Paris, 75002Éducation : Bac +5 / MasterExpérience : Non spécifiéPostulerWho are they?🔭 Stockly is a tech-retail company solving the supply/demand mismatch in e-commerce.With our technology, we connect in real-time e-commerce websites in need for stock with the inventory of hundreds of other retailers who have the same products available, and who can fulfill the order on their behalf.E-retailers can sell products they don’t own, while others can gain additional sales, in a seamless experience for the end-consumer.🏆 Our mission is to create the world’s 1st globally shared inventory for retail. To better understand what we do, check out our french pitch at BFMTV (🇫🇷), or our English pitch at Techstars (🇬🇧).🚀 We’ve already raised $20M+ with European top-tier investors among which Daphni, Eurazeo and Raise. Our proprietary technology, coded in-house from scratch, is already live across Europe with 450+ e-retailers, we grow x4 each year and won’t stop there.Want to know more about Stockly?Company culture, jobs… Let’s go for an immersion!Visit the profileRencontrez Eliott, CEORencontrez Oscar, CTORencontrez Camille, Software EngineerJob description🔎 In a nutshell, what are we looking for?We are looking for a smart and talented full-time team-member to join our Business team. This team is already composed of 6 amazing members (e.g. Pierre, Matthieu, Ilayda, Yann). You will also be directly working with our CEO EliottDue to our strong growth, this number is likely to increase quite rapidly. (Believe it or not, 18 months ago it was a solo team!)We are looking for a CDI to start as soon as possible.🏈 About your future TeamThe Business team is in charge of signing new partners. The team has a pivotal role in Stockly’s growth and has already successfully signed hundreds of European partners (retailers, marketplaces and brands).Over the past years typical missions of the team included:Reach out to hundreds of (e)retailers all over Europe from a very curative brand to a distributor generating +1bn€ in salesUnderstand customer needs and buying cycle to gather key prospect information, generate interest and bring in successful partnersQualification, contacts, demos & closing from inbound & outbound leads. You are always the first touchpoint with the client until the partner is signed!Negotiate the best deals for Stockly and our partners. Always aim for a win-win situation🧑🚀 About your future job🎯 Objectives: what could be examples of your first quarter objectives?Objective: Close 15 new retailers and 5 new brandsPerformance measurement: number of closings and business potential of the new partnersTasks: owning the deal from A to Z (identifying the partner, initiating first contact, demonstrating Stockly’s value, handling the contract…)🥊 Challenges: what are the challenges / problems you will solve?Dealing with a lot of complexity specific to some partners, in an ever-expanding technical environment & thriving sectorBeing responsible for establishing tomorrow’s Stockly network by handpicking new partnersLeading the negotiations with the future retailers: be tenacious to demonstrate the value of Stockly for them, be understanding to find the best deal for everyoneClosing deals autonomouslyPreparing contractsManaging side-projects to improve the overall team’s performanceDeal with a wide range of targets and working styles (e.g. large and small companies, many different countries and cultures…)📚 Learnings: what will you learn?Understand how Stockly and its tech work to add even more value to the company and to its new partnersHow e-commerce works, business models, used technology, problems the retailers encounter every dayHow to pitch to a very large variety of players (we work with retailers all over the European Union, with very various cultures, languages and backgrounds)How to close a clean business deal from A to ZHow to be efficient and optimise your timeHow to create the best processes to keep the organization super efficient and to help you reach your objectives🔭 Projection: At Stockly, you make the collective grow and we want to make you grow as well, what would be the next moves for you with us?Possibility to have a lot of weight over how we do things – we are still a super young companyMore and more autonomy on your deals or negotiations overtimeMore and more complex deals overtimeBuilding the right processes to help scale the teamTraining newcomersManaging a squad in the teamYou will also be directly working with our CEO Eliott💝 About your future benefitsCompetitive packages: for this position, package range is typically from 45k€ (fixed + uncapped On-target Earnings) depending on the profile (e.g. basic knowledge to expert). We have a well defined and objective salary grid that is based on both skills level and scarcity of profiles 💸BSPCE 🚀Health insurance provided by Alan 💊Meal vouchers by Swile 🍽️50% reimbursement of your Navigo Pass 🚋A central and amazing working environment in le Sentier (Paris) 💼Flexible and remote-friendly policy 🏡Stockly dinners together every other Thursday 🍻Stockly breafkasts together every other Friday 🥐Coffee, tea and fruits available everyday 🍇Climbing & football team 🧗⚙️ About how we workEvery team has a daily meeting to align on priorities and solve issues ⇒ You won’t be left alone!Every Monday we have a global weekly meeting where every team shares what they are working on and what they will do for the coming week ⇒ You will have visibility on the whole company!Every quarter we have our OKR meeting (Objectives, Key Results) where each team shows the results of the previous quarter and the objectives of the following one ⇒ You will see the company grow and your own role inside of it!During all these meetings everyone can challenge each other and all questions are more than welcome ⇒ Transparency is one of our key values, and we are always open to new ideas!Preferred experienceWe are looking for a great balance between hard skills and soft skills !🧑💻 Hard skillsLogic: you love logical problems and are strong in reasoning 📐Data drivenEducation: from a business background 🎓Languages: Fluent in English 🇬🇧 and Spanish is a plus but not mandatory 🇪🇸🤝 Soft skillsSmart, curious and a fast learner: you don’t know everything, but you can learn anythingTenacious: you never give up even when it is complexAmbitious: you are ready to reshape the global e-commerce landscape with usNice, humble and friendly: you love learning from others and humbly sharing knowledge with themAutonomous and hard working: you know how to manage your tasks independently and ask for help when neededGood at first contact and patient👊 So if you see yourself in the shoes of a Stockler – don’t hesitate! 👊Recruitment process🏎️ Our process goes fast, we are reactive and we adapt to your availabilities, we can typically go through the whole process in 2-3 weeks:30min video-call with a member of our Talent Acquisition team – To understand your background and motivations, and reply to your questions30min entry-test to be sent by email – You will have some time to do it at home1-hour face to face(or remote) interview with our Head of Ops Pierre or Eliott our CEO- To have a deeper discussionHalf-a-day immersion at Stockly to meet all the team (on site or in remote) – Meet the team, put yourself in the shoes of a Stockler, ask all your questionsReference checks – Quick reference calls with contacts you would provide us🎉 Final offer 🎉🏡 Part of the process can be done remotely if you have constraintsSTOCKLYCette offre vous tente ?PostulerQUESTIONS AND ANSWERS ABOUT THE OFFERIs it mandatory to send a CV?Does this position allow remote work?What type of contract is offered for this position?Is a cover letter mandatory to apply for this position?What is the start date of the contract?D’autres offres de CommercialCes offres peuvent vous intéresser !AlgoliaPartner Account Manager – GermanyCDIParisTélétravail total possibleil y a 4 heuresJCDecauxChef de Publicité IDF (H/F)CDIGennevilliersil y a 4 heuresNexityConseiller Immobilier H/F NGIPCDIParisil y a 4 heuresFinance ActiveReal Estate Sales ExecutiveCDIParisil y a 4 heuresThalesIngénieur commercial Naval (H/F)CDIGennevilliersil y a 4 heuresProsolResponsable adjoint – Produits de la mer (H/F)CDIRueil-Malmaisonil y a 5 heuresVoir toutes les offresNous construisons la nouvelle expérience au travailA PROPOSConceptQui sommes-nous ?Offres d’emploiOffres de stageCentre d’aideNOUS RENCONTRERHuman After AlldotConferencesPresseJobsTarifsCandidats : besoin d’aide ?Assistance entrepriseLA NEWSLETTER QUI FAIT LE TAFUne fois par semaine, des histoires, des jobs et des conseils dans votre boite mail.Abonnez-vous !Vous pouvez vous désabonner à tout moment. On n’est pas susceptibles, promis. Pour en savoir plus sur notre politique de protection des données, cliquez-iciDevenir clientConnexion clientMentions légalesCGUPolitique de confidentialitéCharte Welcome to the JunglePolitique cookiesGestion des cookiesFrance (FR)Axeptio consent | https://www.welcometothejungle.com/fr/companies/stockly/jobs/cdi-business-success-associate_paris?q=0696b72f8ef0a95bcb5ac4a8c509eff6&o=1281317&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Stockly | AccueilTrouver un jobTrouver une entrepriseMédiaDevenir clientSe connecterWho are they?Job descriptionPreferred experienceRecruitment processSTOCKLYKey Account Manager – CDI – ParisCDI Début : 19 mars 2023Salaire entre 50K € et 70K €8, Rue du Sentier, Paris, 75002Télétravail ponctuel autoriséÉducation : Bac +5 / MasterExpérience : > 2 ansL’ENTREPRISEStocklyLogiciels, E-commerceEntre 50 et 250 salariésLE POSTEKey Account Manager – CDI – ParisCDI Début : 19 mars 2023Salaire entre 50K € et 70K €8, Rue du Sentier, Paris, 75002Télétravail ponctuel autoriséÉducation : Bac +5 / MasterExpérience : > 2 ansPostulerWho are they?🔭 Stockly is a tech-retail company solving the supply/demand mismatch in e-commerce.With our technology, we connect in real-time e-commerce websites in need for stock with the inventory of hundreds of other retailers who have the same products available, and who can fulfill the order on their behalf.E-retailers can sell products they don’t own, while others can gain additional sales, in a seamless experience for the end-consumer.🏆 Our mission is to create the world’s 1st globally shared inventory for retail. To better understand what we do, check out our french pitch at BFMTV (🇫🇷), or our English pitch at Techstars (🇬🇧).🚀 We’ve already raised $20M+ with European top-tier investors among which Daphni, Eurazeo and Raise. Our proprietary technology, coded in-house from scratch, is already live across Europe with 450+ e-retailers, we grow x4 each year and won’t stop there.Want to know more about Stockly?Company culture, jobs… Let’s go for an immersion!Visit the profileRencontrez Eliott, CEORencontrez Oscar, CTORencontrez Camille, Software EngineerJob descriptionThe Position🔎 In a nutshell, what we look for?We are looking for a smart and talented full-time team-member to join our Business team. This team is already composed of 6 amazing members (e.g. Matthieu, Ilayda, Yann). You will be directly working with our CEO Eliott or our Head of Network & Growth PierreDue to our strong growth, this number is likely to increase quite rapidly.We are looking for a CDI to start as soon as possible.🏈 About your future TeamThe Business team is in charge of maintaining the relationship with our partners. The team has a pivotal role in Stockly’s growth and has already successfully satisfied hundreds of suppliers.Over the past years typical missions of the team would include:Reach more than 300 suppliers in the Stockly networkSupervising the integration process for new partners, internally and with the partnerIdentifying new opportunities within the network of either increasing turnover or reducing the number of Operations actions per € of turnoverMonitoring our pool of supply and ensuring a quality of service adaptable to any partnerDetect, analyze and solve all abnormal behaviors, errors or mistakes from suppliers🧑🚀 About your future job🎯 Objectives: what could be examples of your first quarter objectives?Objective: Ensure 100% retention rate with existing partnersPerformance measurement: number of partners that churnTasks: maintain regular contacts, respond to questions and worries from partners🥊 Challenges: what are the challenges / problems you will solve?Deal with a lot of complexity specific (or not) to some partners, in an ever-expanding technical environmentLead the negotiations with the retailers, be tenacious to demonstrate the value of Stockly for themManage side-projects to improve the overall team’s performances📚 Learnings: what will you learn?How e-commerce works, business models, used technology, problems the retailers encounter every dayHow to pitch to a very large variety of players (we work with retailers all over European Union, with very various cultures, languages and backgrounds)How to create strong and reliable business relationships with other companiesHow to use the sharpest toolsHow to create the best processes to keep the organization super efficient and to help you reach your objectivesUnderstand how Stockly works internally to add even more value to the company🔭 Projection: At Stockly, you make the collective grow and we want to make you grow as well, what would be the next moves for you with us?Possibility to have a lot of weight over how we do things – we are still a young companyMore and more autonomy on your deals or negotiations overtimeMore and more complex deals overtimeBuilding the right processes to help scale the teamLeading relationships with business indirect partnersTraining newcomers💝 About your future benefitsCompetitive packages: for this position, package range is typically 45k-60k€ depending on the profile (e.g. basic knowledge to expert). We have a well defined and objective salary grid that is based on both skills level and scarcity of profiles 💸BSPCE 🚀Health insurance provided by Alan 💊Meal vouchers by Swile 🍽️50% reimbursement of your Navigo Pass 🚋A central and amazing working environment in le Sentier (Paris) 💼Flexible and remote-friendly policy 🏡Stockly dinners together every other Thursday 🍻Stockly breafkasts together every other Friday 🥐Coffee, tea and fruits available everyday 🍇Climbing & football team 🧗⚙️ About how we workEvery team has a daily meeting to align on priorities and solve issues ⇒ You won’t be left alone!Every Monday we have a global weekly meeting where every team shares what they are working on and what they will do for the coming week ⇒ You will have visibility on the whole company!Every quarter we have our OKR meeting (Objectives, Key Results) where each team shows the results of the previous quarter and the objectives of the following one ⇒ You will see the company grow and your own role inside of it!During all these meetings everyone can challenge each other and all questions are more than welcome ⇒ Transparency is one of our key values, and we are always open to new ideas!Preferred experienceWe are looking for a great balance between hard skills and soft skills !🧑•💻 Hard skillsLogic: you love logical problems and are strong in reasoning 📐Data drivenEducation: from a business background 🎓Languages: Fluent in English 🇬🇧 Spanish is a plus but not mandatory 🇪🇸🤝 Soft skillsSmart, curious and a fast learner: you don’t know everything, but you can learn anythingTenacious: you never give up even when it is complexAmbitious: you are ready to reshape the global e-commerce landscape with usNice, humble and friendly: you love learning from others and humbly sharing knowledge with themAutonomous and hard working: you know how to manage your tasks independently and ask for help when neededGood at first contact and patient👊 So if you see yourself in the shoes of a Stockler – don’t hesitate! 👊Recruitment process🏎️ Our process goes fast, we are reactive and we adapt to your availabilities, we can typically go through the whole process in 2-3 weeks:30min video-call with a member of our Talent Acquisition team – To understand your background and motivations, and reply to your questions30mn entry-test to be sent by email – You will have some time to do it at home1-hour face to face(or remote) interview with our Head of Network, Pierre, or Eliott, our CEO- To have a deeper discussionHalf-a-day immersion at Stockly to meet all the team (on site or in remote) – Meet the team, put yourself in the shoes of a Stockler, ask all your questionsReference checks – Quick reference calls with contacts you would provide us🎉 Final offer 🎉🏡 Part of the process can be done remotely if you have constraintsSTOCKLYCette offre vous tente ?PostulerQUESTIONS AND ANSWERS ABOUT THE OFFERIs it mandatory to send a CV?Does this position allow remote work?What type of contract is offered for this position?Is a cover letter mandatory to apply for this position?What is the start date of the contract?D’autres offres de Account ManagementCes offres peuvent vous intéresser !LittleBig Connection[MRU] [LB] [Business Account Specialist] [UDC] – 2023CDIParisil y a 6 heuresShareGroopCustomer Success Manager – CDICDIParisTélétravail partiel possibleil y a 17 heuresSimpléboCustomer Success Manager (H/F)CDIParisTélétravail partiel possibleil y a 19 heuresPublicis FranceClient Development Associate/ Advertising Account Manager (H/F)CDIParishierStocklyStrategic Partnership Manager – CDI – ParisCDIParisavant-hierBack MarketAccount ManagerCDIParisavant-hierVoir toutes les offresNous construisons la nouvelle expérience au travailA PROPOSConceptQui sommes-nous ?Offres d’emploiOffres de stageCentre d’aideNOUS RENCONTRERHuman After AlldotConferencesPresseJobsTarifsCandidats : besoin d’aide ?Assistance entrepriseLA NEWSLETTER QUI FAIT LE TAFUne fois par semaine, des histoires, des jobs et des conseils dans votre boite mail.Abonnez-vous !Vous pouvez vous désabonner à tout moment. On n’est pas susceptibles, promis. Pour en savoir plus sur notre politique de protection des données, cliquez-iciDevenir clientConnexion clientMentions légalesCGUPolitique de confidentialitéCharte Welcome to the JunglePolitique cookiesGestion des cookiesFrance (FR) | https://www.welcometothejungle.com/fr/companies/stockly/jobs/partner-operations_paris?q=0696b72f8ef0a95bcb5ac4a8c509eff6&o=1070553&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Signal | | https://transunion.wd5.myworkdayjobs.com/en-US/transunion/job/Chicago-Illinois/Director–Market-Development–Diversified-Markets—Technology—Information-Services_19022365?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Skopenow | Skip to main contentLinkedInJoin LinkedInEmailPassword (8+ characters)By clicking Agree & Join, you agree to the LinkedIn User Agreement, Privacy Policy, and Cookie Policy.Agree & JoinAlready on Linkedin? Sign inOn LinkedIn, applicants are 4X more likely to get hired through their network | https://www.linkedin.com/jobs/view/sled-account-executive-at-skopenow-3520060347?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Gametime | Data Scientist, Marketing InternREMOTE /DATA /INTERN/ REMOTE APPLY FOR THIS JOBAbout Us:Live experiences help people cross today’s digital divide and focus on what truly connects us – the here, the new, this once-in-a-lifetime moment that’s bringing us together. To fulfill Gametime’s mission of uniting the world through shared experiences, we make it easy for people to discover and access the live experiences that matter most.With platforms on iOS, Android, mobile web and desktop supporting more than 25,000 events across the US and Canada, we are reimagining the event ticket industry in order to move at the speed of life.Position:We are looking for an organized, data-driven, and curious team player to work cross-functionally across the data and marketing teams. As a Data Scientist Intern, you will support and inform various functions to solve business-critical issues, specifically related to our Marketing and Growth efforts. The ideal candidate will be able to thrive in a fast-paced environment and will be able to adapt to changes within the business and the industry.What you’ll dod / own:Identify marketing analytical needs, build/execute analytics, and report findings to functional partners across marketing (PR, CRM, Product Marketing, Performance/Acquisition, etc.)Provide insight into critical business decisions, working closely with the marketing team to answer pressing issuesLeverage analytics and quantitative methods to inform and influence decision-makingInfluence and build relationships with people across all levels of the organization, internally and externallyA little more about you:Entering your junior year of undergraduate studies or in a masters or PHD programProficient in SQLExperience with A/B testing a plusBasic knowledge of the types of marketing campaigns and channelsAbility to identify, analyze, and provide recommendations to complex business decisionsSolid understanding of statistical analysis and experimentation, and capacity to drive conclusions from the analysisAbility to work across disparate data sources to obtain sensible resultsStrong collaboration and communication skillsStrong problem-solving skillsSome experience with Python or RExperience with a data visualization software$25 – $35 an hourAt Gametime pay ranges are subject to change and assigned to a job based on specific market median of similar jobs according to 3rd party salary benchmark surveys. Individual pay within that range can vary for several reasons including skills/capabilities, experience, and available budget.Gametime is committed to bringing together individuals from different backgrounds and perspectives. We strive to create an inclusive environment where everyone can thrive, feel a sense of belonging, and do great work together. As an equal opportunity employer, we prohibit any unlawful discrimination against a job applicant on the basis of their race, color, religion, veteran status, sex, parental status, gender identity or expression, transgender status, sexual orientation, national origin, age, disability or genetic information. We respect the laws enforced by the EEOC and are dedicated to going above and beyond in fostering diversity across our company.APPLY FOR THIS JOBGametime United Home PageJobs powered by | https://jobs.lever.co/gametime/739192d2-7080-489b-8a4c-ef6de25fc276?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| SparkCharge | Skip to main contentLinkedInJoin LinkedInEmailPassword (8+ characters)By clicking Agree & Join, you agree to the LinkedIn User Agreement, Privacy Policy, and Cookie Policy.Agree & JoinAlready on Linkedin? Sign inOn LinkedIn, applicants are 4X more likely to get hired through their networkLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/jobs/view/field-service-technician-sf-at-sparkcharge-3534114462?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| 🇩🇪 Bilanzbuchhalter / Steuerfachangestellte oder gleichwertig in TierschutzorganisationThis job description is in English because it requires 🇩🇪 German-speaking skills to apply.Mit ihrer Arbeit bei uns, tragen sie dazu bei die Welt für Tiere ein kleines Stück besser zu machen. Der Tier- und Naturschutzbund Berlin-Brandenburg e.V. und seine gemeinnützigen Einrichtungen und Unternehmen engagieren sich dafür, Tiere aus schrecklichen Zuständen in ganz Deutschland, Österreich und der Schweiz zu retten. Ein Beispiel dafür ist der “Tierlebenshof Nauen”, ein Zufluchtsort für Tiere in Not auf einem 4,5 Hektar großen ehemaligen Industriegelände in der Stadt Nauen. Bewerben sie sich noch heute und werden sie Teil unseres Teams für die Tiere.AufgabenGemeinsam mit unserem Büroteam sind sie als Buchhalter/in hauptsächlich für folgende Aufgaben verantwortlich.Erfassung aller Zahlungseingänge aus verschiedensten Quellen (Paypal / Sepa-Lastschriften / Kreditkarten / Online-Spendenportale / Bankkonten) und Zuordnung der Zahlungen zu den entsprechenden Organisationen und Spendern in unserem CRM System. Ausfertigung der entsprechenden Spendenbescheinigungen.Verbuchung der Zahlungen in unserem Finanzbuchhaltungssystem (Lexware neue Steuerkanzlei) Erstellung der Abschlüsse und Steuererklärungen.Verbuchung von Rechnungsein- und ausgängen / Kassen. Rechnungslegung zwischen dem Verein und verbundenen Unternehmen.Bearbeitung von Spenderanfragen bezüglich Anlage oder Änderung von Daueraufträgen usw.Prüfung von Eingangsrechnungen und Vorbereiten der entsprechenden Zahlungen in unserer Online-Banking Software.QualifikationAbgeschlossene Ausbildung als Bilanzbuchhalter*in, Steuerfachangestellte oder gleichwertig.Langjährige BerufserfahrungDie Fähigkeit und Bereitschaft sich in die Vielzahl von durch uns genutzen Systemen (CRM´s Spendentools) einzuarbeiten sowie bei der Einführung neuer Systeme mitzuwirken.Ausgezeichnete Kenntnisse von MS Office und Buchhaltungssystemen z.B. Lexware neue Steuerkanzlei.Sie sind in der Lage zeitnah die Arbeit aufzunehmen.BenefitsWas bieten wir dir?Die Möglichkeit durch deine Arbeit dazu beizutragen die Welt für Tiere ein kleines Stück besser zu machen.Eine interessante, vielseitige und durch persönliches Engagement selbst zu gestaltende Aufgabe.Einen festen unbefristeten ArbeitsvertragEine für die Position erstklassige Vergütung abhängig von ihrer Qualifikation und Berufserfahrung30 Tage Urlaub35 Stunden Woche – Gleitzeit möglichVergütung gemäß ihrer QualifikationArbeitsort: REMOTESie können überall auf der Welt arbeiten wo eine stabile Internetverbindung vorhanden ist.Bitte senden sie uns die üblichen ausführlichen Bewerbungsunterlagen unter Angabe ihrer Gehaltsvorstellungen und dem frühest möglichen Eintrittstermin, gern auch als PDF per Email an Herrn Gary Koch | https://remotive.com/remote-jobs/software-dev/bilanzbuchhalter-steuerfachangestellte-oder-gleichwertig-in-tierschutzorganisation-1631713 |
| SparkCharge | Skip to main contentLinkedInJoin LinkedInEmailPassword (8+ characters)By clicking Agree & Join, you agree to the LinkedIn User Agreement, Privacy Policy, and Cookie Policy.Agree & JoinAlready on Linkedin? Sign inOn LinkedIn, applicants are 4X more likely to get hired through their networkLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/jobs/view/field-service-technician-austin-at-sparkcharge-3532648831?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| SparkCharge | Skip to main contentLinkedInJobsDismissDismissJoin nowSign inOperations Manager-SF Bay AreaSparkCharge San Francisco, CA3 days ago 28 applicants See who SparkCharge has hired for this roleApply SaveWe are looking for a Field Operations Supervisor to lead our mobile EV Charging operations in the San Francisco Bay Area. The ideal candidate will have the proven ability to lead a distributed team and a knowledge of EV Charging. This is a full time salaried position.SparkCharge is a fast-growing cleantech start-up that is reducing barriers to Electric Vehicle (EV) adoption. We design, manufacture, and sell portable, Level 3 charging systems for EVs. We also provide “Mobile Charging-as-a-Service” (MCaaS) through our “ Currently” network, which allows EV owners and businesses to schedule an EV charge delivery to wherever their vehicle is located. Be a part of the clean energy solution!Responsibilities:Prepare market with proper re-charging infrastructure, office space, and inventoryService all customers during initial market launch period by hands on chargingUtilize charging equipmentTroubleshoot the equipment and EV if charging is unsuccessfulReport daily and weekly usage and service to managementAbility to use technology to perform high level customer serviceGrow a distributed team of service techniciansProvide training and development for service technicians through effective coachingMaintain local vendor relationshipsResolve escalated customer service issues while working with SparkCharge’s Customer Success departmentPartner with our sales and revenue management team to foster local customer relationships, including corporate partnershipsResponsible for all variable costs including labor, fuel, real estate, van leasing, etc.Implement scalable best practices that are continuously improving the company’s efficienciesReport out on market KPIs and set monthly goals for teamRequirements:Candidates must have:Clean Driver’s license.Excellent or perfect driving record–no moving violations.Ability to pass a thorough background check.Experience leading a distributed field operations team.Desire to innovate and learn with a strong entrepreneurial spirit.Proven history of being punctual, reliable, and courteous.Ability to lift 70lb equipment multiple times per day.Excellent customer service skills; represent the company in a professional manager.Ability to use simple electronic equipment.Additional ” Plus” Experience include:Experience with Electric VehiclesAutomotive industry experienceProficiency in ExcelFleet Management ExperienceBenefits:We are a fast-paced, start-up with a based on our values of togetherness, ownership, passion, resilience and respect. This position qualifies for paid time off. The Company pays over 90% of health insurance premiums for employees. We offer FSA savings and 401(k) plans. Compensation will be based on the candidate’s ability to quickly add value to SparkCharge.Show more Seniority levelMid-Senior levelEmployment typeFull-timeJob functionManagementIndustriesMotor Vehicle Manufacturing Referrals increase your chances of interviewing at SparkCharge by 2xSee who you knowGet notified about new Area Operations Manager jobs in San Francisco, CA.Sign in to create job alertSimilar jobsMedical DirectorMedical DirectorNeuroglee TherapeuticsBoston, MA8 minutes agoLicensed Insurance Agent – Avg $120k First YearLicensed Insurance Agent – Avg $120k First YearInsurTech AdvisorsUnited States1 minute agoFinance ManagerFinance ManagerApeiron BioenergyPathum Thani, Thailand11 minutes agoCRNA Casual Part Time – Alfred I duPont HospitalCRNA Casual Part Time – Alfred I duPont HospitalNemoursWilmington, DE2 minutes agoVape Sales Representative in Europe and the USVape Sales Representative in Europe and the USHiredChina.com 为中国企业链接国际人才Hauts-de-France, France8 minutes agoAutomotive Mechanic/ EngineerAutomotive Mechanic/ EngineerFive Stars Flour Mills Co.Suez, As Suways, EgyptJust nowShow more jobs like this People also viewedSenior Dotnet DeveloperSenior Dotnet DeveloperTIGI HR ®IndiaJust nowPython DeveloperPython DeveloperTata Consultancy ServicesBengaluru, Karnataka, India1 minute agoMedia ExecutiveMedia ExecutiveZenithHong Kong, Hong Kong SAR4 minutes agoTransportation Department SupervisorTransportation Department SupervisorRightPro StaffingSt Albans, VT6 minutes agoFranchise OwnerFranchise OwnerChick-fil-A Corporate Support CenterSalt Lake City, UT14 minutes agoCommunity Loan OfficerCommunity Loan OfficerRegions BankAtlanta, GA4 minutes agoBenefits Analyst (Manager)Benefits Analyst (Manager)ConnectedGroupHong Kong, Hong Kong SARJust nowSenior Comptable – PSF Grandissante, Service Sur-MesureSenior Comptable – PSF Grandissante, Service Sur-MesureAbiomis LuxembourgLuxembourg, Luxembourg, Luxembourg4 minutes agoLaboratory TechnicianLaboratory TechnicianFulton HoganMackay, Queensland, Australia12 minutes ago(Senior) Account Manager, eLearning Sales(Senior) Account Manager, eLearning SalesHKT HomeHong Kong, Hong Kong SAR3 minutes agoLooking for a job?Visit the Career Advice Hub to see tips on interviewing and resume writing.View Career Advice HubLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyYour California Privacy ChoicesCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/jobs/view/operations-manager-sf-bay-area-at-sparkcharge-3522831548?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| SparkCharge | Skip to main contentLinkedInJobsDismissDismissJoin nowSign inField Operations Supervisor-SF Bay AreaSparkCharge San Francisco, CA4 days ago Be among the first 25 applicants See who SparkCharge has hired for this roleApply SaveWe are looking for a Field Operations Supervisor to lead our mobile EV Charging operations in the San Francisco Bay Area. The ideal candidate will have the proven ability to lead a distributed team and a knowledge of EV Charging. This is a full time salaried position.SparkCharge is a fast-growing cleantech start-up that is reducing barriers to Electric Vehicle (EV) adoption. We design, manufacture, and sell portable, Level 3 charging systems for EVs. We also provide “Mobile Charging-as-a-Service” (MCaaS) through our “ Currently” network, which allows EV owners and businesses to schedule an EV charge delivery to wherever their vehicle is located. Be a part of the clean energy solution!Responsibilities:Prepare market with proper re-charging infrastructure, office space, and inventoryService all customers during initial market launch period by hands on chargingUtilize charging equipmentTroubleshoot the equipment and EV if charging is unsuccessfulReport daily and weekly usage and service to managementAbility to use technology to perform high level customer serviceGrow a distributed team of service techniciansProvide training and development for service technicians through effective coachingMaintain local vendor relationshipsResolve escalated customer service issues while working with SparkCharge’s Customer Success departmentPartner with our sales and revenue management team to foster local customer relationships, including corporate partnershipsResponsible for all variable costs including labor, fuel, real estate, van leasing, etc.Implement scalable best practices that are continuously improving the company’s efficienciesReport out on market KPIs and set monthly goals for teamRequirements:Candidates must have:Clean Driver’s license.Excellent or perfect driving record–no moving violations.Ability to pass a thorough background check.Experience leading a distributed field operations team.Desire to innovate and learn with a strong entrepreneurial spirit.Proven history of being punctual, reliable, and courteous.Ability to lift 70lb equipment multiple times per day.Excellent customer service skills; represent the company in a professional manager.Ability to use simple electronic equipment.Additional ” Plus” Experience include:Experience with Electric VehiclesAutomotive industry experienceProficiency in ExcelFleet Management ExperienceBenefits:We are a fast-paced, start-up with a based on our values of togetherness, ownership, passion, resilience and respect. This position qualifies for paid time off. The Company pays over 90% of health insurance premiums for employees. We offer FSA savings and 401(k) plans. Compensation will be based on the candidate’s ability to quickly add value to SparkCharge.Show more Seniority levelMid-Senior levelEmployment typeFull-timeJob functionOtherIndustriesMotor Vehicle Manufacturing Referrals increase your chances of interviewing at SparkCharge by 2xSee who you knowGet notified about new Field Operations Supervisor jobs in San Francisco, CA.Sign in to create job alertSimilar jobsSenior Implementation ConsultantSenior Implementation ConsultantTabSquareHong Kong, Hong Kong SAR16 minutes agoLicensed Insurance Agent – Avg $120k First YearLicensed Insurance Agent – Avg $120k First YearInsurTech AdvisorsUnited States1 minute agoFinance ManagerFinance ManagerApeiron BioenergyPathum Thani, Thailand11 minutes agoCRNA Casual Part Time – Alfred I duPont HospitalCRNA Casual Part Time – Alfred I duPont HospitalNemoursWilmington, DE2 minutes agoVape Sales Representative in Europe and the USVape Sales Representative in Europe and the USHiredChina.com 为中国企业链接国际人才Hauts-de-France, France8 minutes agoPayroll Systems AdministratorPayroll Systems AdministratorFrontier CommunicationsRochester, NY6 minutes agoShow more jobs like this People also viewedSenior OS DeveloperSenior OS DeveloperSGV & Co.Makati, National Capital Region, Philippines14 minutes agoHR Officer ANZHR Officer ANZACCO BrandsBlacktown, New South Wales, Australia13 minutes agoBusiness Development Manager-CloudHuawei Technologies NepalLalitpur District, NepalJust nowSenior Dotnet DeveloperSenior Dotnet DeveloperTIGI HR ®IndiaJust nowMedia ExecutiveMedia ExecutiveZenithHong Kong, Hong Kong SAR4 minutes agoTransportation Department SupervisorTransportation Department SupervisorRightPro StaffingSt Albans, VT6 minutes agoFranchise OwnerFranchise OwnerChick-fil-A Corporate Support CenterSalt Lake City, UT14 minutes agoCommunity Loan OfficerCommunity Loan OfficerRegions BankAtlanta, GA4 minutes agoSenior Comptable – PSF Grandissante, Service Sur-MesureSenior Comptable – PSF Grandissante, Service Sur-MesureAbiomis LuxembourgLuxembourg, Luxembourg, Luxembourg4 minutes agoTCS Hiring for Active directory_KolkataTCS Hiring for Active directory_KolkataTata Consultancy ServicesKolkata, West Bengal, India5 minutes agoLooking for a job?Visit the Career Advice Hub to see tips on interviewing and resume writing.View Career Advice HubLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyYour California Privacy ChoicesCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/jobs/view/field-operations-supervisor-sf-bay-area-at-sparkcharge-3520892776?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| SparkCharge | Skip to main contentLinkedInJobsDismissDismissJoin nowSign inReal Estate & Energy Storage Acquisition ManagerSparkCharge Somerville, MA6 days ago Be among the first 25 applicants See who SparkCharge has hired for this roleApply SaveSparkCharge is currently seeking an experienced real-estate professional with particular experience in project development for grid scale battery storage to support the growth of Currently Fleet Charging across the US network. The candidate will bring a good understanding of acquiring commercial properties that fit the business need and securing rates with utility providers in markets across the US. When not traveling, the position is fully in-office.The candidate must have a proven experience of working with relevant stakeholders, and have the capability and credibility to develop projects.The role will require a deep knowledge of a majority of the following: comfort and experience with being the face of the company in direct, strategic and other negotiations, guidance and closing of real estate agreement processes, a technical understanding of energy storage, utility scale grid analysis and Federal, and State & Local project permitting, working with the Directors and other members of the Mobile Operations and Sales team. The candidate will be able to manage the day-to-day aspects of the project development activities. The role integrates with team members in legal, engineering and operations to develop complex, high-value market developments. The role includes liaising with real estate agents, commercial property owners, Local Authorities, and planning consultants. It will be a requirement to hit the ground running and to be comfortable operating at a rapid pace at times with high levels of ambiguity and the pressure of deadlines. The candidate will directly be responsible for real estate development and strategy.Responsibilities:● Lead and manage commercial real estate search in current and upcoming markets.● Find compelling locations and manage the relationships throughout the property and permitting processes. Very strong legal understanding of applicable real estate agreements.● Interconnection – General understanding of the grid, interconnection process, and risk● Implementing best practice project development processes, working closely with functional teams across the business to support location identification.● Own development strategy, budget, and tracking of spending and exposure for real estate locations.● Site visits to potential locations with real estate brokers across the US● Supporting the closure of deals● Ensure portfolio risks and issues are managed, mitigated and reported appropriately● Manage and create accurate and timely stakeholder reporting, including reporting to internal stakeholders and C-SuiteRequirements:Candidates must have:● Bachelor’s or Master’s degree● Experience in commercial real estate and understanding of the real estate market is preferred.● Ability to travel up to 75% of the time● A genuine passion in clean energy and our social and environmental mission● Strong commercial skills – comfortable with legal contracts and negotiations● Excellent communication skills, capable of presenting project development opportunities● Strong organization skills, team player and good attention to detail● Fluent in PowerPoint and Excel● Desire to work in a fast moving, high pressure and entrepreneurial environmentBenefits:We are a fast-moving start-up with a culture based on our values of togetherness, ownership, passion, resilience and respect. This position qualifies for unlimited PTO. The Company pays over 90% of health insurance premiums for employees. We offer FSA savings and 401(k) plans. Compensation will be based on the candidate’s ability to quickly add value to SparkCharge.Show more Seniority levelMid-Senior levelEmployment typeFull-timeJob functionGeneral BusinessIndustriesAppliances, Electrical, and Electronics Manufacturing Referrals increase your chances of interviewing at SparkCharge by 2xSee who you knowGet notified about new Acquisition Manager jobs in Somerville, MA.Sign in to create job alertSimilar jobsSenior Implementation ConsultantSenior Implementation ConsultantTabSquareHong Kong, Hong Kong SAR16 minutes agoLicensed Insurance Agent – Avg $120k First YearLicensed Insurance Agent – Avg $120k First YearInsurTech AdvisorsUnited States1 minute agoFinance ManagerFinance ManagerApeiron BioenergyPathum Thani, Thailand11 minutes agoCRNA Casual Part Time – Alfred I duPont HospitalCRNA Casual Part Time – Alfred I duPont HospitalNemoursWilmington, DE2 minutes agoVape Sales Representative in Europe and the USVape Sales Representative in Europe and the USHiredChina.com 为中国企业链接国际人才Hauts-de-France, France8 minutes agoPayroll Systems AdministratorPayroll Systems AdministratorFrontier CommunicationsRochester, NY6 minutes agoShow more jobs like this People also viewedSenior OS DeveloperSenior OS DeveloperSGV & Co.Makati, National Capital Region, Philippines14 minutes agoHR Officer ANZHR Officer ANZACCO BrandsBlacktown, New South Wales, Australia13 minutes agoBusiness Development Manager-CloudHuawei Technologies NepalLalitpur District, NepalJust nowSenior Dotnet DeveloperSenior Dotnet DeveloperTIGI HR ®IndiaJust nowMedia ExecutiveMedia ExecutiveZenithHong Kong, Hong Kong SAR4 minutes agoTransportation Department SupervisorTransportation Department SupervisorRightPro StaffingSt Albans, VT6 minutes agoFranchise OwnerFranchise OwnerChick-fil-A Corporate Support CenterSalt Lake City, UT14 minutes agoCommunity Loan OfficerCommunity Loan OfficerRegions BankAtlanta, GA4 minutes agoSenior Comptable – PSF Grandissante, Service Sur-MesureSenior Comptable – PSF Grandissante, Service Sur-MesureAbiomis LuxembourgLuxembourg, Luxembourg, Luxembourg4 minutes agoTCS Hiring for Active directory_KolkataTCS Hiring for Active directory_KolkataTata Consultancy ServicesKolkata, West Bengal, India5 minutes agoLooking for a job?Visit the Career Advice Hub to see tips on interviewing and resume writing.View Career Advice HubLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyYour California Privacy ChoicesCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/jobs/view/real-estate-energy-storage-acquisition-manager-at-sparkcharge-3518189591?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| 🇩🇪 Digital Marketing ManagerThis job description is in German because it requires German-speaking skills. 🇩🇪 Remote oder hybridWerde Teil des Superfly Teams.Das sind wirUnter der Marke SUPERFLY werden mit über 500 Mitarbeitern und in 13 Parks branchenführend Freizeit- und Sportparks mit einer Mischung aus Trampolinen, Luftsportarten und anderen Attraktionen betrieben.SUPERFLY AIR SPORTS Parks sind mit einer Grundfläche von 2.500 m2 bis über 4.000 m2 Anlagen der Superlative und Trendsetter im Bereich Indoor-Sport.Zusammen mit der Muttergesellschaft gehört SUPERFLY zu den weltweit größten Betreibern und Entwicklern von Indoor-Trampolin-Parks und zählt in Deutschland zu den Marktführern.Deine Aufgaben bei unsDu bist die Queen oder der King unserer Owned ChannelsDu entwickelst unsere digitalen Kanäle (Website, Newsletter, SEO/SEA, Social Media) weiter und hebst sie auf das nächste LevelDu analysierst Performance-Daten, wertest aus und leitest daraus spezifische Handlungsempfehlungen abDu kümmerst dich um die digitale Customer Experience auf allen Kanälen und erarbeitest zielgruppenspezifischen ContentDu arbeitest eng mit unseren Partner-Agenturen und Entwicklern im Bereich SEA, Social Media und Web-Development zusammen und übernimmst deren Steuerung in Bezug auf Kampagnen- und Content-AussteuerungDu hast die Kontrolle über unsere Marketing-Automationskampagnen und entwickelst kreative Wege unsere Kunden besser und besser und besser anzusprechenDu treibst unsere Lead-Generierung und Optimierung mit kreativen Ideen voranDu hilfst uns dabei, unsere Marktführerschaft weiter auszubauen – #skyIsTheLimitDu kannst dich bei uns kreativ austoben. Solange die Performance stimmt, sind wir dabei!Du passt zu unsDu bist ein MarkeTIER und konntest dein Können bereits unter Beweis stellen oder dich weiterentwickelnDu bringst bereits praktische Kenntnisse in der laufenden Betreuung von Websites, digitalen Plattformen unter Einsatz von Content-Management-Systemen, Usability, Nutzerführung und Erfolgskontrolle auf Agentur- oder Unternehmensseite mit – GREAT!CPC, HTML, CTR, SEA, SEO, ROAS und CR sind für dich nicht nur Buchstabenkombinationen, sondern sind Teil deiner PassionRetargeting, E-Mail-Marketing und Performance Optimierung ist Teil deiner digitalen DNADu erfüllst nicht alle unsere Wünsche? DON’T PANIC! Schick uns einfach deine Bewerbung und überzeuge uns – wir stehen auf coole PersönlichkeitenWir bieten DirWork remote und/oder hybrid – ob vom Café, von zuhause oder aus unserem Butzbacher Office heraus -You decide!Corporate BenefitsEin stabiler Zusammenhalt – nicht nur im Team, sondern im gesamten UnternehmenWir leben den persönlichen und familiären AustauschJaaa, es steht mittlerweile überall – aber auch in unserer Küche gibt’s kostenlose warme und (eis)kalte GetränkeWERTSCHÄTZUNG und ANERKENNUNG wird bei uns großgeschriebenAch so, haben wir schon erwähnt, dass wir Marktführer in der Trampolinpark-Branche sind?eine unbefristete Stelle in einem SUPERFLYtastischen Team__Unser Team ist von Superfly Air Sports begeistert. Du wirst es auch sein.__ | https://remotive.com/remote-jobs/marketing/digital-marketing-manager-1628618 |
| Senior Simulation Software EngineerAt Lightelligence, our team is developing cutting-edge technology at the forefront of photonic computing. With a culture of internal mobility, we offer opportunities to thrive in a variety of disciplines. This is a place for dreamers and doers to succeed.As a remote Senior Simulation Software Engineer, you will work with colleagues primarily in the UTC-5 (US east) timezone, where you will build reusable, flexible models to support our hardware–software codesign efforts. This includes network-traffic simulation along with functional, performance, and power simulation for high-performance computing applications that incorporate our photonics components.What you’ll be doing at Lightelligence:Building reusable simulation models and tools in C, C++, and/or PythonParticipating in all phases of development, from requirement gathering to deploymentWorking closely with our photonics, hardware, and compiler teams to guide upcoming product developmentRequirementsCore QualificationsIf you meet 80% of the qualifications below, or you have other strengths that would benefit out team, we encourage you to apply!Bachelor’s degree in a relevant discipline (e.g., computer science, hardware) OR 5+ years of relevant professional experience.Clear verbal and written communication in EnglishStrong programming skills with (C or C++) and PythonHands-on experience building hardware simulationsHands-on experience with source-control tools (e.g., git)Experience with test-driven developmentAvailability for morning or evening meetings with our colleagues overseasNOTE: This position is not available for candidates who live near the Boston area. See our “onsite” job listing instead.Bonus QualificationsProficiency with simulation toolkits/languages like Imperas, Gem5, SystemCProficiency with GitLabAbility to read and speak MandarinPassion for modeling and codesigning novel opto-electronic acceleratorsBenefitsCompany subsidized health, vision, and dental benefits 3 weeks PTO and 1 week of paid sick leave 401 (k) with an employer contribution 10 Paid holidays A great place to work!Lightelligence is an Equal Opportunity Employer and does not discriminate against any employee or applicant for employment because of race, color, sex, age, national origin, religion, sexual orientation, gender identity and/or expression, status as a veteran, and basis of disability or any other federal, state or local protected class. | https://remotive.com/remote-jobs/software-dev/senior-simulation-software-engineer-1619742 |
| Mona | Cellar Door ManagerJob No: MONA532 Location: Campania, TasmaniaPart-time and Full-time options available$70,000 annualised + superStoney Vineyard is the oldest in Tassie’s Coal River Valley, but the Domaine A Cellar Door onsite is newly renovated and one-of-a-kind. The team at Moorilla need an enthusiastic and experienced hospitality professional to manage Domaine A Cellar Door by continuing to elevate their current offering and manage the continued evolution of the space. This role will report to the Retail Operations Manager, but will have trust and autonomy to lead this venue’s operations and the chance to have input into the journey. The Cellar Door is set on a peaceful and picturesque vineyard, and is newly renovated to give guests an incredible and unique experience as part of the renowned Coal River Valley. In this role, the Manager will use their wine and hospitality knowledge to ensure the guest experience is world class by training and supervising a small team, opening and closing the venue, hosting tastings and running daily operations. This isn’t a normal Cellar Door role though – this Cellar Door is part of the exciting and ever-changing Mona world and we need someone who will approach these changes with excitement and an open-mind. The Gig:Provide outstanding and informative service to customers and lead other staff to do the same, showcasing our Moorilla and Domaine A productsLead wine tastings for large and diverse groups, and manage VIP events and tastings either independently, with a team or in collaboration with the Retail Operations ManagerBuild, mentor and train a team for the venue in collaboration with the Retail managerSupervise and coordinate the rostering of casual staff membersUnderstand, plate and sell our locally sourced food offerings to guestsSupervise and lead cleaning and work health safety practices for Cellar DoorRespond to customer emails & booking requests, and other administrative duties as requiredBe an ambassador for the Coal River Valley region, collaborating with other cellar doors, local businesses and tour operatorsThe You:Prior experience in a similar role, or significant hospitality experience coupled with a strong wine knowledgeProfessionally presented, with highly developed interpersonal skills, and delivers a high standard of customer serviceCapable of maintaining engagement and productivity when working autonomously and when supervising staffExcited and capable with managing and leading changeExperienced with computer-based and administrative tasksAvailability and flexibility with working hours and timesCurrent driver’s licence requiredDoes this sound like you? We want to meet you! Apply below. Applications will be reviewed as they come in. Personal Details* Required fieldFirst name* Last name*E-mail* Mobile*Digits only or add + for international numbersStreet* Street Cont. City, Town or Suburb* Postcode or Zipcode* Country*Please choose…AFGHANISTANALBANIAALGERIAAMERICAN SAMOAANDORRAANGOLAANGUILLAANTIGUA AND BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAUSTRIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELGIUMBELIZEBENINBERMUDABHUTANBOLIVIABOSNIA AND HERZEGOVINABOTSWANABRAZILBRUNEI DARUSSALAMBULGARIABURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL AFRICAN REPUBLICCHADCHILECHINACOLOMBIACOMOROSCONGOCONGO, THE DEMOCRATIC REPUBLIC OF THECOOK ISLANDSCOSTA RICACOTE D’IVOIRECROATIACUBACYPRUSCZECH REPUBLICDENMARKDJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAESTONIAETHIOPIAFALKLAND ISLANDS (MALVINAS)FAROE ISLANDSFIJIFINLANDFRANCEFRENCH GUIANAFRENCH POLYNESIAGABONGAMBIAGEORGIAGERMANYGHANAGIBRALTARGREECEGREENLANDGRENADAGUADELOUPEGUAMGUATEMALAGUINEAGUINEA-BISSAUGUYANAHAITIHOLY SEE (VATICAN CITY STATE)HONDURASHONG KONGHUNGARYICELANDINDIAINDONESIAIRAN, ISLAMIC REPUBLIC OFIRAQIRELANDISRAELITALYJAMAICAJAPANJORDANKAZAKHSTANKENYAKIRIBATIKOREA, DEMOCRATIC PEOPLE’S REPUBLIC OFKOREA, REPUBLIC OFKUWAITKYRGYZSTANLAO PEOPLE’S DEMOCRATIC REPUBLICLATVIALEBANONLESOTHOLIBERIALIBYAN ARAB JAMAHIRIYALIECHTENSTEINLITHUANIALUXEMBOURGMACAOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMADAGASCARMALAWIMALAYSIAMALDIVESMALIMALTAMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMEXICOMICRONESIA, FEDERATED STATES OFMOLDOVA, REPUBLIC OFMONACOMONGOLIAMONTSERRATMOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNETHERLANDSNETHERLANDS ANTILLESNEW CALEDONIANEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN MARIANA ISLANDSNORWAYOMANPAKISTANPALAUPANAMAPAPUA NEW GUINEAPARAGUAYPERUPHILIPPINESPITCAIRNPOLANDPORTUGALPUERTO RICOQATARREUNIONROMANIARUSSIAN FEDERATIONRWANDASAINT HELENASAINT KITTS AND NEVISSAINT LUCIASAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESSAMOASAN MARINOSAO TOME AND PRINCIPESAUDI ARABIASENEGALSEYCHELLESSIERRA LEONESINGAPORESLOVAKIASLOVENIASOLOMON ISLANDSSOMALIASOUTH AFRICASPAINSRI LANKASUDANSURINAMESVALBARD AND JAN MAYENSWAZILANDSWEDENSWITZERLANDSYRIAN ARAB REPUBLICTAIWAN, PROVINCE OF CHINATAJIKISTANTANZANIA, UNITED REPUBLIC OFTHAILANDTOGOTOKELAUTONGATRINIDAD AND TOBAGOTUNISIATURKEYTURKMENISTANTURKS AND CAICOS ISLANDSTUVALUUGANDAUKRAINEUNITED ARAB EMIRATESUNITED KINGDOMUNITED STATESURUGUAYUZBEKISTANVANUATUVENEZUELAVIET NAMVIRGIN ISLANDS, BRITISHVIRGIN ISLANDS, U.S.WALLIS AND FUTUNAWESTERN SAHARAYEMENZAMBIAZIMBABWEINTERNATIONALOTHERUnknown State, Region or Province*Please choose…QuestionsOutline your experience in hospitality or the wine industry.*What excites you most about this role?*What is your favourite wine? Why?*Save for laterNextYour IP address (70.132.18.141) has been logged. 50 Hits.Terms and Conditions | Privacy Policy | https://mona.applynow.net.au/jobs/MONA532-cellar-door-manager?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Mona | Build SupervisorJob No: MONA529 Location: Berriedale, HobartResponsibility for build and maintenance works across Mona’s sitesPrefab, installation and general maintenance duties with supervisory oversightFull time and ongoing role based at BerriedaleWe are on the hunt for a highly motivated and capable individual to join our Facilities and Assets department as the Build Team Leader. This role is responsible for the implementation of planning, resourcing, scheduling and delivery of building and maintenance works at Mona and other associated sites. This position ensures any works are completed in accordance with specifications and legislative requirements using quality construction methods in a safe environment.The successful candidate will be a strong communicator and collaborator with experience in supervising teams to lead a skilled workforce of internal, cross-departmental and external talent. The Build Team Leader will thrive in a dynamic environment and will use their keen eye, initiative and problem solving skills to deliver quality building and maintenance services while constantly juggling priorities.The Gig:Working with Facilities and Assets staff, promote and implement best practice and monitor progress in line with Capex and Opex plans and schedules for the delivery of assigned works.Prefabrication and/or installation of joinery/cabinetry and general maintenance repairs.Using MEX software, process requests, delegate, and log maintenance requests from around the organization; create and activate planned/preventative maintenance eg. Test and tag, plant servicing; ensure tasks are closed out in MEX by tradesmen to ensure accurate reporting.Provide input to Build Manager to ensure building and maintenance design, plant and equipment is given appropriate consideration in the context of building operations and compliance, and visitor experience.Provide leadership and mentoring to Build team employees, facilitating opportunities to upskill employees to establish and maintain consistently high standards and provide input to performance planning and reviews.Contribute to the development and management budgets.Manage suppliers and contractors in line with the contractual requirementsEnsure the team and contractors comply with Work Health and Safety requirements and have a focus on health, safety, and welfare within all aspects of service planning and deliveryAssist with purchasing of tools and equipment that contribute to safe work practices.The You:Considerable experience acquired over a number of years working in a similar role, including managing a team of trades, labourers, and contractors in construction context.A relevant trade qualification in Carpentry/Joinery or Certificate IV in Building and Construction Management (mandatory) & Builders RegistrationContract management skills including development and management of scopes of work, specifications, variations, payment claims, and defects liability.Highly developed communication skills, capable of communicating and negotiating across clusters with a diverse range of stakeholders.Strong time management skills with attention to detail and quality with the ability to solve problems and drive results.Prior experience supervising a team is essential. This ideally involved developing a strong team culture, identifying training opportunities for employees that build on existing strengths.A highly motivated approach, capable of working autonomously in an environment that experiences constant change and disruption.A manual drivers licence, Forklift and/or Boom Lift licence (mandatory)It sounds like the perfect job, right? So apply! Submit your CV and cover letter before applications close on Wednesday, 29 March at 9am.Privacy AcknowledgmentCollection of Personal Information The Museum of Old & New Art (Mona) is collecting personal information from you as part of the recruitment and selection process. Mona recognises the importance of privacy and is committed to ensuring the privacy of your personal information collected and/or received by us. Mona’s recruitment applications are hosted by external service providers who also recognises the importance of privacy. By proceeding with your application, you acknowledge that your personal information will be hosted by these external service providers until such time as you elect not to have your information stored on these external hosted sites.Yes I agree to the privacy statement*Personal Details* Required fieldFirst name* Last name*E-mail* Mobile*Digits only or add + for international numbersStreet* Street Cont. City, Town or Suburb* Postcode or Zipcode* Country*Please choose…AFGHANISTANALBANIAALGERIAAMERICAN SAMOAANDORRAANGOLAANGUILLAANTIGUA AND BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAUSTRIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELGIUMBELIZEBENINBERMUDABHUTANBOLIVIABOSNIA AND HERZEGOVINABOTSWANABRAZILBRUNEI DARUSSALAMBULGARIABURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL AFRICAN REPUBLICCHADCHILECHINACOLOMBIACOMOROSCONGOCONGO, THE DEMOCRATIC REPUBLIC OF THECOOK ISLANDSCOSTA RICACOTE D’IVOIRECROATIACUBACYPRUSCZECH REPUBLICDENMARKDJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAESTONIAETHIOPIAFALKLAND ISLANDS (MALVINAS)FAROE ISLANDSFIJIFINLANDFRANCEFRENCH GUIANAFRENCH POLYNESIAGABONGAMBIAGEORGIAGERMANYGHANAGIBRALTARGREECEGREENLANDGRENADAGUADELOUPEGUAMGUATEMALAGUINEAGUINEA-BISSAUGUYANAHAITIHOLY SEE (VATICAN CITY STATE)HONDURASHONG KONGHUNGARYICELANDINDIAINDONESIAIRAN, ISLAMIC REPUBLIC OFIRAQIRELANDISRAELITALYJAMAICAJAPANJORDANKAZAKHSTANKENYAKIRIBATIKOREA, DEMOCRATIC PEOPLE’S REPUBLIC OFKOREA, REPUBLIC OFKUWAITKYRGYZSTANLAO PEOPLE’S DEMOCRATIC REPUBLICLATVIALEBANONLESOTHOLIBERIALIBYAN ARAB JAMAHIRIYALIECHTENSTEINLITHUANIALUXEMBOURGMACAOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMADAGASCARMALAWIMALAYSIAMALDIVESMALIMALTAMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMEXICOMICRONESIA, FEDERATED STATES OFMOLDOVA, REPUBLIC OFMONACOMONGOLIAMONTSERRATMOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNETHERLANDSNETHERLANDS ANTILLESNEW CALEDONIANEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN MARIANA ISLANDSNORWAYOMANPAKISTANPALAUPANAMAPAPUA NEW GUINEAPARAGUAYPERUPHILIPPINESPITCAIRNPOLANDPORTUGALPUERTO RICOQATARREUNIONROMANIARUSSIAN FEDERATIONRWANDASAINT HELENASAINT KITTS AND NEVISSAINT LUCIASAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESSAMOASAN MARINOSAO TOME AND PRINCIPESAUDI ARABIASENEGALSEYCHELLESSIERRA LEONESINGAPORESLOVAKIASLOVENIASOLOMON ISLANDSSOMALIASOUTH AFRICASPAINSRI LANKASUDANSURINAMESVALBARD AND JAN MAYENSWAZILANDSWEDENSWITZERLANDSYRIAN ARAB REPUBLICTAIWAN, PROVINCE OF CHINATAJIKISTANTANZANIA, UNITED REPUBLIC OFTHAILANDTOGOTOKELAUTONGATRINIDAD AND TOBAGOTUNISIATURKEYTURKMENISTANTURKS AND CAICOS ISLANDSTUVALUUGANDAUKRAINEUNITED ARAB EMIRATESUNITED KINGDOMUNITED STATESURUGUAYUZBEKISTANVANUATUVENEZUELAVIET NAMVIRGIN ISLANDS, BRITISHVIRGIN ISLANDS, U.S.WALLIS AND FUTUNAWESTERN SAHARAYEMENZAMBIAZIMBABWEINTERNATIONALOTHERUnknown State, Region or Province*Please choose…QuestionsWhy are you interested in applying for this role at Mona?*Do you hold a trade qualification? In which field?*Save for laterNextYour IP address (70.132.18.72) has been logged. 197 Hits.Terms and Conditions | Privacy Policy | https://mona.applynow.net.au/jobs/MONA529-build-supervisor?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Mona | Cellar Door SupervisorJob No: MONA533 Location: Berriedale / CampaniaFull-time, Part-time and Casual roles availableMoorilla was one of Tasmania’s first vineyards, and Stoney Vineyard is the oldest in Tasmania’s Coal River Valley. These exceptional wineries operate together under the guidance of Winemaker Conor van der Reest and the Moorilla team, as part of the wider Mona family. As an important addition to this team, Moorilla is looking for an experienced and passionate hospitality professional to join as a Cellar Door Supervisor. This dynamic and customer facing role will be located at both of our Cellar Doors (Moorilla and Domaine A) and require someone who enjoys learning with and educating staff and customers. In this role you will provide support to the Retail Manager through staff management, customer engagement and leading operations. You will need an enthusiasm and knowledge for wine and exceptional customer service skills as you will be leading wine tastings and supporting the team to showcase our Moorilla & Domaine A products to our diverse customers.The Gig:Provide outstanding and informative service to customers and lead other staff to do the same, showcasing our Moorilla and Domaine A productsLead wine tastings alongside the Cellar Door team as well as support the Retail Operations Manager with VIP groups or eventsProcess sales through our retail system and perform end of day procedures as requiredSupport the Retail Manager with training and educating of new staffMaintain equipment and stock inventories and regularly perform stock takesSupervise and lead cleaning and work health safety practices for Cellar DoorUndertake administrative tasks as requiredThe You:Prior experience in a similar role, or significant hospitality experience coupled with a strong wine passion and/or knowledgeProfessionally presented, with highly developed interpersonal skills, and able to deliver a high standard of customer serviceCapable of maintaining engagement and productivity when working autonomously and when supervising staffExperienced with computer-based and administrative tasksMust hold a valid and current Responsible Service of Alcohol (RSA) certificate and a current driver’s licenseAvailability and flexibility with working hours, days and locationsIf this sounds like you, we’d love to hear from you. Please answer the questions below and attach your resume. Applications will be reviewed as they come in. Personal Details* Required fieldFirst name* Last name*E-mail* Mobile*Digits only or add + for international numbersStreet* Street Cont. City, Town or Suburb* Postcode or Zipcode* Country*Please choose…AFGHANISTANALBANIAALGERIAAMERICAN SAMOAANDORRAANGOLAANGUILLAANTIGUA AND BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAUSTRIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELGIUMBELIZEBENINBERMUDABHUTANBOLIVIABOSNIA AND HERZEGOVINABOTSWANABRAZILBRUNEI DARUSSALAMBULGARIABURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL AFRICAN REPUBLICCHADCHILECHINACOLOMBIACOMOROSCONGOCONGO, THE DEMOCRATIC REPUBLIC OF THECOOK ISLANDSCOSTA RICACOTE D’IVOIRECROATIACUBACYPRUSCZECH REPUBLICDENMARKDJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAESTONIAETHIOPIAFALKLAND ISLANDS (MALVINAS)FAROE ISLANDSFIJIFINLANDFRANCEFRENCH GUIANAFRENCH POLYNESIAGABONGAMBIAGEORGIAGERMANYGHANAGIBRALTARGREECEGREENLANDGRENADAGUADELOUPEGUAMGUATEMALAGUINEAGUINEA-BISSAUGUYANAHAITIHOLY SEE (VATICAN CITY STATE)HONDURASHONG KONGHUNGARYICELANDINDIAINDONESIAIRAN, ISLAMIC REPUBLIC OFIRAQIRELANDISRAELITALYJAMAICAJAPANJORDANKAZAKHSTANKENYAKIRIBATIKOREA, DEMOCRATIC PEOPLE’S REPUBLIC OFKOREA, REPUBLIC OFKUWAITKYRGYZSTANLAO PEOPLE’S DEMOCRATIC REPUBLICLATVIALEBANONLESOTHOLIBERIALIBYAN ARAB JAMAHIRIYALIECHTENSTEINLITHUANIALUXEMBOURGMACAOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMADAGASCARMALAWIMALAYSIAMALDIVESMALIMALTAMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMEXICOMICRONESIA, FEDERATED STATES OFMOLDOVA, REPUBLIC OFMONACOMONGOLIAMONTSERRATMOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNETHERLANDSNETHERLANDS ANTILLESNEW CALEDONIANEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN MARIANA ISLANDSNORWAYOMANPAKISTANPALAUPANAMAPAPUA NEW GUINEAPARAGUAYPERUPHILIPPINESPITCAIRNPOLANDPORTUGALPUERTO RICOQATARREUNIONROMANIARUSSIAN FEDERATIONRWANDASAINT HELENASAINT KITTS AND NEVISSAINT LUCIASAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESSAMOASAN MARINOSAO TOME AND PRINCIPESAUDI ARABIASENEGALSEYCHELLESSIERRA LEONESINGAPORESLOVAKIASLOVENIASOLOMON ISLANDSSOMALIASOUTH AFRICASPAINSRI LANKASUDANSURINAMESVALBARD AND JAN MAYENSWAZILANDSWEDENSWITZERLANDSYRIAN ARAB REPUBLICTAIWAN, PROVINCE OF CHINATAJIKISTANTANZANIA, UNITED REPUBLIC OFTHAILANDTOGOTOKELAUTONGATRINIDAD AND TOBAGOTUNISIATURKEYTURKMENISTANTURKS AND CAICOS ISLANDSTUVALUUGANDAUKRAINEUNITED ARAB EMIRATESUNITED KINGDOMUNITED STATESURUGUAYUZBEKISTANVANUATUVENEZUELAVIET NAMVIRGIN ISLANDS, BRITISHVIRGIN ISLANDS, U.S.WALLIS AND FUTUNAWESTERN SAHARAYEMENZAMBIAZIMBABWEINTERNATIONALOTHERUnknown State, Region or Province*Please choose…QuestionsPlease outline your hospitality and/or wine experience.*What excites you about this role?*What is your availability throughout the week for both Cellar Door locations?*Save for laterNextYour IP address (70.132.18.151) has been logged. 46 Hits.Terms and Conditions | Privacy Policy | https://mona.applynow.net.au/jobs/MONA533-cellar-door-supervisor?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Mona | Farm LabourerJob No: MONA534 Location: Marion BayMarion BayFull TimeThis role is to support the Marion Bay Caretaker to maintain the Marchwiel property at Marion Bay — a 1500+ hectare waterfront property that has multiple accommodation offerings, occasional events and various agricultural functions. There is a focus on land rehabilitation and the position calls on a broad spectrum of generalist maintenance, groundskeeping and agricultural skills and knowledge.This role reports to the existing Marchwiel Caretaker and forms part of the broad Mona Facilities and Assets in Berriedale.The Gig:General groundskeeping activity — mowing, brush cutting, knapsack & herbicide spraying, landscapingGrounds maintenance — Tractor operations, irrigation, fence assembly and repairGeneral building, equipment and machinery maintenance.Native tree care, propagation and pruning.Infrastructure troubleshooting and repair.Logistical support with event setup and pack downThe You:Prior experience in a similar role essentialRelevant certificate is advantageous.Drivers license and reliable transportAvailable to work flexibly, including weekendsAbility to problem solve and work independently, contributing within a broader teamPhysically fit of performing a labour intensive role for an extended period of timeA positive attitude with a willingness to learn and contribute as an effective team memberSound communication skills to facilitate effective team workMona’s continually evolving culture is a reflection on the attitudes and behaviour of the staff who make our workplace a unique, supportive and enjoyable environment. As an employee of Mona, it is your responsibility to contribute to this culture through displaying a positive and cooperative attitude, and by ensuring the mental and physical wellbeing of yourself and your colleagues is prioritised in the undertaking of your work.If this sounds like you, we’d love to hear from you. Applications close Friday 7th March. Personal Details* Required fieldFirst name* Last name*E-mail* Mobile*Digits only or add + for international numbersStreet* Street Cont. City, Town or Suburb* Postcode or Zipcode* Country*Please choose…AFGHANISTANALBANIAALGERIAAMERICAN SAMOAANDORRAANGOLAANGUILLAANTIGUA AND BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAUSTRIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELGIUMBELIZEBENINBERMUDABHUTANBOLIVIABOSNIA AND HERZEGOVINABOTSWANABRAZILBRUNEI DARUSSALAMBULGARIABURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL AFRICAN REPUBLICCHADCHILECHINACOLOMBIACOMOROSCONGOCONGO, THE DEMOCRATIC REPUBLIC OF THECOOK ISLANDSCOSTA RICACOTE D’IVOIRECROATIACUBACYPRUSCZECH REPUBLICDENMARKDJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAESTONIAETHIOPIAFALKLAND ISLANDS (MALVINAS)FAROE ISLANDSFIJIFINLANDFRANCEFRENCH GUIANAFRENCH POLYNESIAGABONGAMBIAGEORGIAGERMANYGHANAGIBRALTARGREECEGREENLANDGRENADAGUADELOUPEGUAMGUATEMALAGUINEAGUINEA-BISSAUGUYANAHAITIHOLY SEE (VATICAN CITY STATE)HONDURASHONG KONGHUNGARYICELANDINDIAINDONESIAIRAN, ISLAMIC REPUBLIC OFIRAQIRELANDISRAELITALYJAMAICAJAPANJORDANKAZAKHSTANKENYAKIRIBATIKOREA, DEMOCRATIC PEOPLE’S REPUBLIC OFKOREA, REPUBLIC OFKUWAITKYRGYZSTANLAO PEOPLE’S DEMOCRATIC REPUBLICLATVIALEBANONLESOTHOLIBERIALIBYAN ARAB JAMAHIRIYALIECHTENSTEINLITHUANIALUXEMBOURGMACAOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMADAGASCARMALAWIMALAYSIAMALDIVESMALIMALTAMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMEXICOMICRONESIA, FEDERATED STATES OFMOLDOVA, REPUBLIC OFMONACOMONGOLIAMONTSERRATMOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNETHERLANDSNETHERLANDS ANTILLESNEW CALEDONIANEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN MARIANA ISLANDSNORWAYOMANPAKISTANPALAUPANAMAPAPUA NEW GUINEAPARAGUAYPERUPHILIPPINESPITCAIRNPOLANDPORTUGALPUERTO RICOQATARREUNIONROMANIARUSSIAN FEDERATIONRWANDASAINT HELENASAINT KITTS AND NEVISSAINT LUCIASAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESSAMOASAN MARINOSAO TOME AND PRINCIPESAUDI ARABIASENEGALSEYCHELLESSIERRA LEONESINGAPORESLOVAKIASLOVENIASOLOMON ISLANDSSOMALIASOUTH AFRICASPAINSRI LANKASUDANSURINAMESVALBARD AND JAN MAYENSWAZILANDSWEDENSWITZERLANDSYRIAN ARAB REPUBLICTAIWAN, PROVINCE OF CHINATAJIKISTANTANZANIA, UNITED REPUBLIC OFTHAILANDTOGOTOKELAUTONGATRINIDAD AND TOBAGOTUNISIATURKEYTURKMENISTANTURKS AND CAICOS ISLANDSTUVALUUGANDAUKRAINEUNITED ARAB EMIRATESUNITED KINGDOMUNITED STATESURUGUAYUZBEKISTANVANUATUVENEZUELAVIET NAMVIRGIN ISLANDS, BRITISHVIRGIN ISLANDS, U.S.WALLIS AND FUTUNAWESTERN SAHARAYEMENZAMBIAZIMBABWEINTERNATIONALOTHERUnknown State, Region or Province*Please choose…Save for laterNextYour IP address (70.132.18.151) has been logged. 179 Hits.Terms and Conditions | Privacy Policy | https://mona.applynow.net.au/jobs/MONA534-farm-labourer?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Mona | General employment registerJob No: MONA4 Location: Berriedale, TasmaniaThanks for your interest in working with us!Please submit your general expression of interest to work with us by completing the below application process. If an opportunity arises that we feel you could be suitable for, we may be in touch. Otherwise, we encourage you to keep an eye out for any specific employment opportunities and submit a direct application if there is a role that connects to your areas of interest and expertise. Thank you, Mona Recruitment Team Privacy AcknowledgmentCollection of Personal Information The Museum of Old & New Art (Mona) is collecting personal information from you as part of the recruitment and selection process. Mona recognises the importance of privacy and is committed to ensuring the privacy of your personal information collected and/or received by us. Mona’s recruitment applications are hosted by external service providers who also recognises the importance of privacy. By proceeding with your application, you acknowledge that your personal information will be hosted by these external service providers until such time as you elect not to have your information stored on these external hosted sites.Yes I agree to the privacy statement*Personal Details* Required fieldFirst name* Last name*E-mail* Mobile*Digits only or add + for international numbersStreet* Street Cont. City, Town or Suburb* Postcode or Zipcode* Country*Please choose…AFGHANISTANALBANIAALGERIAAMERICAN SAMOAANDORRAANGOLAANGUILLAANTIGUA AND BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAUSTRIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELGIUMBELIZEBENINBERMUDABHUTANBOLIVIABOSNIA AND HERZEGOVINABOTSWANABRAZILBRUNEI DARUSSALAMBULGARIABURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL AFRICAN REPUBLICCHADCHILECHINACOLOMBIACOMOROSCONGOCONGO, THE DEMOCRATIC REPUBLIC OF THECOOK ISLANDSCOSTA RICACOTE D’IVOIRECROATIACUBACYPRUSCZECH REPUBLICDENMARKDJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAESTONIAETHIOPIAFALKLAND ISLANDS (MALVINAS)FAROE ISLANDSFIJIFINLANDFRANCEFRENCH GUIANAFRENCH POLYNESIAGABONGAMBIAGEORGIAGERMANYGHANAGIBRALTARGREECEGREENLANDGRENADAGUADELOUPEGUAMGUATEMALAGUINEAGUINEA-BISSAUGUYANAHAITIHOLY SEE (VATICAN CITY STATE)HONDURASHONG KONGHUNGARYICELANDINDIAINDONESIAIRAN, ISLAMIC REPUBLIC OFIRAQIRELANDISRAELITALYJAMAICAJAPANJORDANKAZAKHSTANKENYAKIRIBATIKOREA, DEMOCRATIC PEOPLE’S REPUBLIC OFKOREA, REPUBLIC OFKUWAITKYRGYZSTANLAO PEOPLE’S DEMOCRATIC REPUBLICLATVIALEBANONLESOTHOLIBERIALIBYAN ARAB JAMAHIRIYALIECHTENSTEINLITHUANIALUXEMBOURGMACAOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMADAGASCARMALAWIMALAYSIAMALDIVESMALIMALTAMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMEXICOMICRONESIA, FEDERATED STATES OFMOLDOVA, REPUBLIC OFMONACOMONGOLIAMONTSERRATMOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNETHERLANDSNETHERLANDS ANTILLESNEW CALEDONIANEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN MARIANA ISLANDSNORWAYOMANPAKISTANPALAUPANAMAPAPUA NEW GUINEAPARAGUAYPERUPHILIPPINESPITCAIRNPOLANDPORTUGALPUERTO RICOQATARREUNIONROMANIARUSSIAN FEDERATIONRWANDASAINT HELENASAINT KITTS AND NEVISSAINT LUCIASAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESSAMOASAN MARINOSAO TOME AND PRINCIPESAUDI ARABIASENEGALSEYCHELLESSIERRA LEONESINGAPORESLOVAKIASLOVENIASOLOMON ISLANDSSOMALIASOUTH AFRICASPAINSRI LANKASUDANSURINAMESVALBARD AND JAN MAYENSWAZILANDSWEDENSWITZERLANDSYRIAN ARAB REPUBLICTAIWAN, PROVINCE OF CHINATAJIKISTANTANZANIA, UNITED REPUBLIC OFTHAILANDTOGOTOKELAUTONGATRINIDAD AND TOBAGOTUNISIATURKEYTURKMENISTANTURKS AND CAICOS ISLANDSTUVALUUGANDAUKRAINEUNITED ARAB EMIRATESUNITED KINGDOMUNITED STATESURUGUAYUZBEKISTANVANUATUVENEZUELAVIET NAMVIRGIN ISLANDS, BRITISHVIRGIN ISLANDS, U.S.WALLIS AND FUTUNAWESTERN SAHARAYEMENZAMBIAZIMBABWEINTERNATIONALOTHERUnknown State, Region or Province*Please choose…QuestionsDo you have the legal right to work in Australia?*YesNoMona is a diverse organisation, in which area are you seeking to gain employment?*Briefly explain what motivates you to work with our team?Save for laterNextYour IP address (70.132.18.86) has been logged. 47730 Hits.Terms and Conditions | Privacy Policy | https://mona.applynow.net.au/jobs/MONA4-general-employment-register?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Mona | ICT User Support TechnicianJob No: MONA531 Location: Berriedale2 roles available – 1 full-time permanent, 1 full-time 6 month parental leave replacement Work onsite at Mona (Berriedale) and other Hobart sites, with flexible work options availableSalary range $55-60k, plus superWe are seeking two ICT User Support Technicians to join the Mona team to provide frontline technical support across all of our business units. You will be rostered across MONA sites, primarily at our main site in Berriedale but with the need to travel to support other sites. To be successful in this role you will need to have strong interpersonal skills, a broad range of technical and troubleshooting knowledge and enjoy working in a high-change environment.The Gig:Provide user support for Mona technical systems.Provide support for Windows 10 and Macintosh OSX operating systems.Troubleshoot and resolve computer hardware, software, and installation-related issues.Provide support for functions and events (on occasion outside of business hours).Research, test, document and resolve technical problems.Maintenance of existing technical documentation to ensure currency and aesthetic appeal.Support users of audiovisual and unified communications systems.Acquisition of IT equipment as required.Provide training and advice on technical systems.Other relevant tasks or duties as directed.The You:Strong interpersonal skills.Able to work within a rotating roster providing weekend on site support.Excellent oral and written communication skills.Desire to provide best in class support with a focus on client satisfaction.Good general knowledge of information technology and audiovisual systems.Demonstrated skills to provide support for Microsoft and Mac operating systems.Ability to troubleshoot computer hardware issues.Knowledge of IP networking.Excellent organisational skills and ability to work on a number of projects simultaneously.Ability to work efficiently independently and in a fast-moving team environment.Ability to continually adapt and learn new methods and software packages.Excellent analytical, problem-solving, and detail-oriented skills.Ability to be creative and apply innovative concepts to problem resolution.Current drivers licence and vehicle.Does this sound like you? Great! Let’s talk. Privacy AcknowledgmentCollection of Personal Information The Museum of Old & New Art (Mona) is collecting personal information from you as part of the recruitment and selection process. Mona recognises the importance of privacy and is committed to ensuring the privacy of your personal information collected and/or received by us. Mona’s recruitment applications are hosted by external service providers who also recognises the importance of privacy. By proceeding with your application, you acknowledge that your personal information will be hosted by these external service providers until such time as you elect not to have your information stored on these external hosted sites.Yes I agree to the privacy statement*Personal Details* Required fieldFirst name* Last name*E-mail* Mobile*Digits only or add + for international numbersStreet* Street Cont. City, Town or Suburb* Postcode or Zipcode* Country*Please choose…AFGHANISTANALBANIAALGERIAAMERICAN SAMOAANDORRAANGOLAANGUILLAANTIGUA AND BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAUSTRIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELGIUMBELIZEBENINBERMUDABHUTANBOLIVIABOSNIA AND HERZEGOVINABOTSWANABRAZILBRUNEI DARUSSALAMBULGARIABURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL AFRICAN REPUBLICCHADCHILECHINACOLOMBIACOMOROSCONGOCONGO, THE DEMOCRATIC REPUBLIC OF THECOOK ISLANDSCOSTA RICACOTE D’IVOIRECROATIACUBACYPRUSCZECH REPUBLICDENMARKDJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAESTONIAETHIOPIAFALKLAND ISLANDS (MALVINAS)FAROE ISLANDSFIJIFINLANDFRANCEFRENCH GUIANAFRENCH POLYNESIAGABONGAMBIAGEORGIAGERMANYGHANAGIBRALTARGREECEGREENLANDGRENADAGUADELOUPEGUAMGUATEMALAGUINEAGUINEA-BISSAUGUYANAHAITIHOLY SEE (VATICAN CITY STATE)HONDURASHONG KONGHUNGARYICELANDINDIAINDONESIAIRAN, ISLAMIC REPUBLIC OFIRAQIRELANDISRAELITALYJAMAICAJAPANJORDANKAZAKHSTANKENYAKIRIBATIKOREA, DEMOCRATIC PEOPLE’S REPUBLIC OFKOREA, REPUBLIC OFKUWAITKYRGYZSTANLAO PEOPLE’S DEMOCRATIC REPUBLICLATVIALEBANONLESOTHOLIBERIALIBYAN ARAB JAMAHIRIYALIECHTENSTEINLITHUANIALUXEMBOURGMACAOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMADAGASCARMALAWIMALAYSIAMALDIVESMALIMALTAMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMEXICOMICRONESIA, FEDERATED STATES OFMOLDOVA, REPUBLIC OFMONACOMONGOLIAMONTSERRATMOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNETHERLANDSNETHERLANDS ANTILLESNEW CALEDONIANEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN MARIANA ISLANDSNORWAYOMANPAKISTANPALAUPANAMAPAPUA NEW GUINEAPARAGUAYPERUPHILIPPINESPITCAIRNPOLANDPORTUGALPUERTO RICOQATARREUNIONROMANIARUSSIAN FEDERATIONRWANDASAINT HELENASAINT KITTS AND NEVISSAINT LUCIASAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESSAMOASAN MARINOSAO TOME AND PRINCIPESAUDI ARABIASENEGALSEYCHELLESSIERRA LEONESINGAPORESLOVAKIASLOVENIASOLOMON ISLANDSSOMALIASOUTH AFRICASPAINSRI LANKASUDANSURINAMESVALBARD AND JAN MAYENSWAZILANDSWEDENSWITZERLANDSYRIAN ARAB REPUBLICTAIWAN, PROVINCE OF CHINATAJIKISTANTANZANIA, UNITED REPUBLIC OFTHAILANDTOGOTOKELAUTONGATRINIDAD AND TOBAGOTUNISIATURKEYTURKMENISTANTURKS AND CAICOS ISLANDSTUVALUUGANDAUKRAINEUNITED ARAB EMIRATESUNITED KINGDOMUNITED STATESURUGUAYUZBEKISTANVANUATUVENEZUELAVIET NAMVIRGIN ISLANDS, BRITISHVIRGIN ISLANDS, U.S.WALLIS AND FUTUNAWESTERN SAHARAYEMENZAMBIAZIMBABWEINTERNATIONALOTHERUnknown State, Region or Province*Please choose…QuestionsBriefly describe what interests you most about this role*Save for laterNextYour IP address (70.132.18.81) has been logged. 374 Hits.Terms and Conditions | Privacy Policy | https://mona.applynow.net.au/jobs/MONA531-ict-user-support-technician?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Mona | Payroll and Administration Assistant – People & CultureJob No: MONA530 Location: BerriedaleParental leave cover with flexible work options availableJoin a collaborative P&C team supporting employees on their Mona journeySalary range $60 – $70k, plus superMona employs a diverse group of individuals in a broad range of interesting areas. From music festivals to beer, vineyards and a recording studio, a few restaurants and a lot of art…. And the list goes on. The organisation constantly evolves its experiences, spaces and people, and with that in mind, we’re looking for an action-ready Payroll and Admin Assistant to support the People & Culture team.As the first point of contact for any HR and payroll enquiries, you’ll work closely with the P&C Business Partners and Payroll Manager to nurture employees on their Mona journey. You will provide administrative support for a variety of people processes so no two days are ever the same.THE GIG:Triage all HR and Payroll queries, escalating when appropriateProactive coordination of P&C activities including team meetings and eventsGenerating offers of employment and administration of onboarding processesAdministration of employee feedback including onboarding and exit surveysSupporting P&C Business Partners to maintain and monitor work visa complianceEnd to end processing of the fortnightly payroll, including timesheets and leaveMaintain system data including Employment Hero, Culture Amp, Igloo and LucidityTHE YOU:A confident and experienced administrator with HR or Payroll experience preferred. Relevant qualifications will be highly regarded.Eager to learn in a dynamic and diverse working environmentAble to build rapport with a broad range of people and flex your style accordinglyHighly organised and skilled in prioritising workload, thinking ahead to scheduled surge periods and working systematically through bulk onboarding periodsStrong attention to detail and motivated by the challenge of developing and maintaining processes and proceduresA resilient, calm and friendly demeanour, willing to contribute to various initiativesMona is a unique place. If you’re ready to have skin in the game and think you can find calm in the chaos, apply now! Privacy AcknowledgmentCollection of Personal Information The Museum of Old & New Art (Mona) is collecting personal information from you as part of the recruitment and selection process. Mona recognises the importance of privacy and is committed to ensuring the privacy of your personal information collected and/or received by us. Mona’s recruitment applications are hosted by external service providers who also recognises the importance of privacy. By proceeding with your application, you acknowledge that your personal information will be hosted by these external service providers until such time as you elect not to have your information stored on these external hosted sites.Yes I agree to the privacy statement*Personal Details* Required fieldFirst name* Last name*E-mail* Mobile*Digits only or add + for international numbersStreet* Street Cont. City, Town or Suburb* Postcode or Zipcode* Country*Please choose…AFGHANISTANALBANIAALGERIAAMERICAN SAMOAANDORRAANGOLAANGUILLAANTIGUA AND BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAUSTRIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELGIUMBELIZEBENINBERMUDABHUTANBOLIVIABOSNIA AND HERZEGOVINABOTSWANABRAZILBRUNEI DARUSSALAMBULGARIABURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL AFRICAN REPUBLICCHADCHILECHINACOLOMBIACOMOROSCONGOCONGO, THE DEMOCRATIC REPUBLIC OF THECOOK ISLANDSCOSTA RICACOTE D’IVOIRECROATIACUBACYPRUSCZECH REPUBLICDENMARKDJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAESTONIAETHIOPIAFALKLAND ISLANDS (MALVINAS)FAROE ISLANDSFIJIFINLANDFRANCEFRENCH GUIANAFRENCH POLYNESIAGABONGAMBIAGEORGIAGERMANYGHANAGIBRALTARGREECEGREENLANDGRENADAGUADELOUPEGUAMGUATEMALAGUINEAGUINEA-BISSAUGUYANAHAITIHOLY SEE (VATICAN CITY STATE)HONDURASHONG KONGHUNGARYICELANDINDIAINDONESIAIRAN, ISLAMIC REPUBLIC OFIRAQIRELANDISRAELITALYJAMAICAJAPANJORDANKAZAKHSTANKENYAKIRIBATIKOREA, DEMOCRATIC PEOPLE’S REPUBLIC OFKOREA, REPUBLIC OFKUWAITKYRGYZSTANLAO PEOPLE’S DEMOCRATIC REPUBLICLATVIALEBANONLESOTHOLIBERIALIBYAN ARAB JAMAHIRIYALIECHTENSTEINLITHUANIALUXEMBOURGMACAOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMADAGASCARMALAWIMALAYSIAMALDIVESMALIMALTAMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMEXICOMICRONESIA, FEDERATED STATES OFMOLDOVA, REPUBLIC OFMONACOMONGOLIAMONTSERRATMOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNETHERLANDSNETHERLANDS ANTILLESNEW CALEDONIANEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN MARIANA ISLANDSNORWAYOMANPAKISTANPALAUPANAMAPAPUA NEW GUINEAPARAGUAYPERUPHILIPPINESPITCAIRNPOLANDPORTUGALPUERTO RICOQATARREUNIONROMANIARUSSIAN FEDERATIONRWANDASAINT HELENASAINT KITTS AND NEVISSAINT LUCIASAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESSAMOASAN MARINOSAO TOME AND PRINCIPESAUDI ARABIASENEGALSEYCHELLESSIERRA LEONESINGAPORESLOVAKIASLOVENIASOLOMON ISLANDSSOMALIASOUTH AFRICASPAINSRI LANKASUDANSURINAMESVALBARD AND JAN MAYENSWAZILANDSWEDENSWITZERLANDSYRIAN ARAB REPUBLICTAIWAN, PROVINCE OF CHINATAJIKISTANTANZANIA, UNITED REPUBLIC OFTHAILANDTOGOTOKELAUTONGATRINIDAD AND TOBAGOTUNISIATURKEYTURKMENISTANTURKS AND CAICOS ISLANDSTUVALUUGANDAUKRAINEUNITED ARAB EMIRATESUNITED KINGDOMUNITED STATESURUGUAYUZBEKISTANVANUATUVENEZUELAVIET NAMVIRGIN ISLANDS, BRITISHVIRGIN ISLANDS, U.S.WALLIS AND FUTUNAWESTERN SAHARAYEMENZAMBIAZIMBABWEINTERNATIONALOTHERUnknown State, Region or Province*Please choose…QuestionsTell us about your experience, including the administrative roles you have held and the industry you’re familiar with. If you’re just starting out, tell us what interests you about the role.*In this role, you will need to balance multiple tasks at once. How do you approach priority setting when you have multiple stakeholders?*How would you take up the role in your first 3 months? What does ‘success’ look like?*Save for laterNextYour IP address (70.132.18.74) has been logged. 564 Hits.Terms and Conditions | Privacy Policy | https://mona.applynow.net.au/jobs/MONA530-payroll-and-administration-assistant-people-culture?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Dyania Health | Skip to main contentLinkedInJoin LinkedInEmailPassword (8+ characters)By clicking Agree & Join, you agree to the LinkedIn User Agreement, Privacy Policy, and Cookie Policy.Agree & JoinAlready on Linkedin? Sign inOn LinkedIn, applicants are 4X more likely to get hired through their network | https://www.linkedin.com/jobs/view/3385046321/?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Optera | | https://opteraclimate.com/wp-content/uploads/2022/12/Optera-Job-Description-Senior-Product-Manager-.pdf?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Whistic | Sign InCareer CenterCurrent OpeningsLanguageJoin Our Talent CommunityShareGeneral ApplicationPleasant Grv, UT, US30+ days agoRequisition ID: 1127ApplyGeneral ApplicationWhistic is growing and we are always looking for top talent. If you are interested in Whistic but don’t see an open role that fits what you are looking for, we would still love to talk with you. Please feel free to submit a general application and tell us more about yourself. Whistic is a values-driven organization that cares not only about what we accomplish, but also how we accomplish our goals. Whistic’s core values are: purposeful prioritization, extreme ownership, startup mentality, driven by data, and voracious learning. These values guide everything we do; If they resonate with you, we’d love to hear from you. BenefitsStock optionsMedical, dental, and vision insuranceCompany paid life insurancePaid parental leave17 Paid Holidays15 Days PTO (All available your 1st day) + 2 additional days each year of employment!3 Whistic DNA Days- Company-paid “Family Day”, “Self Day”, & “Community Day”Whistic Fridays- Work ends at 3:00 PM every FridayA world-class culture and employee experience!What Our Employees Say About Whistic: “I love working at Whistic. It makes me feel excited to come to work and be a partof something special.” “Working at Whistic, I feel like an important member of my team and the company, in an environment that promotes growth and excellence.”“Whistic’s culture shows a level of care for members of the company I haven’t experienced elsewhere.” See What It’s Like to be a Whistician on Glassdoor! Whistic’s DEIB CommitmentWhistic is a place where you can be you. It’s impossible to separate what you do from who you are, and we don’t want you to. In fact, we want just the opposite. When Whisticians share the richness of their experiences, personal connections are deepened, new levels of collaboration are unleashed, and our product innovation accelerates. We become unstoppable.Whistic is committed to growing diversity, equity, inclusion, and belonging across three key dimensions:Workforce Representation: Hiring and retaining a diverse team Fairness: Equitable rewards, recognition, and opportunities based on merit Inclusive Culture: Fostering an inclusive culture where differences are celebratedAbout WhisticWhistic is on a mission to become the Vendor Security Network where buyers and sellers establish and maintain ongoing connections, enabling faster business decisions. Here’s how it works: When a company is seeking out a vendor that will have access to its sensitive data, that company must assess the vendor to ensure it meets certain information security thresholds. This assessment process results in cumbersome, clunky, and slow spreadsheets emailed back and forth — eating up info security resources and ultimately delaying deals. That’s where Whistic comes in. Our market-defining platform enables security and sales teams to proactively conduct and respond to third party security assessments by streamlining and automating the process, transforming the work for companies all over the world, saving professionals valuable time, and ultimately helping to safeguard sensitive information. Whistic is an Equal Opportunity Employer.Copyright © 2023, ADP, Inc. All rights reserved.Privacy|Legal|RequirementsPowered byBackApply | https://workforcenow.adp.com/mascsr/default/mdf/recruitment/recruitment.html?cid=eb547a33-3a55-47ce-9c34-b85bc9451fb6&ccId=19000101_000001&lang=en_US&selectedMenuKey=CurrentOpenings&jobId=447970&utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| backstitch | TOTAL COMPENSATIONEMPLOYEE APPINTERNAL NEWSLETTERSBLOGSOLUTIONSSUPPORTCome JoinOur Growing TeamWe’re always looking for talented and passionate team members that want to grow their career at a fast-moving startup building products for the largest employers in their industry.Open Positions inKansas City, MOCome work in the heart of the KC Crossroads District. “2020 Top 10 Startups to Watch: backstitch”- Startland NewsFull-Stack Software EngineerThis role will have you take ownership over future customer-facing products as well as assist in scaling our existing suite of applications.ApplyProduct OwnerThe Product Owner helps ensure our software platform consisting of multiple web and mobile app products meets the needs of the market and the user.This role will require partnering and collaborating closely with multiple teams to collect customer-driven feedback, prioritize the product roadmap, and define software development scope.ApplyUI/UX Designerbackstitch is looking for a forward-thinking UI/UX Designer to help optimize the usability of our software platform consisting of multiple web and mobile app products. This role will require partnering and collaborating closely with multiple teams to plan product direction, collect customer-driven feedback, and define engineering scope.ApplyEnterprise Sales Executivebackstitch is looking for an experienced B2B Software Sales Executive looking to grow their career at a fast growing startup working with some of the most well known companies in the world.This position requires confidence to build relationships and solve challenges for Director, VP and C-suite level executives as you will be responsible for growing revenue across a national territory.Applybackstitch was named as one of:”Kansas City’s Top VC-Backed Companies in 2020″Read Article Benefits We Offer:100% Employer Covered Medical Plan.Flexible Schedule and Uncapped Paid VacationCompany Stock OptionsPerks We Offer:Free Snacks, Coffee, and BeerCasual Office Environment in the KC Crossroads DistrictRegular Company Events and OutingsBrand New 15″ Macbook Pro w/ Touch BarDual 24″ MonitorsiPad w/ Apple PencilStanding Desk Apply Now KANSAS CITY, MO1627 Main St. #1200Kansas City, MO 64108Google Maps Generator by embedgooglemap.netTopics we care aboutHow to Prioritize a Work Environment That Supports EveryoneHow Does Employee Engagement Affect the Employee Experience?Financial Wellness is the Key to Employee EngagementEmployment Law Changes for 2023Help Employees Make the Most of Their Benefits Before the Year EndsEmployment Law Changes for December 2022Celebrate Your Employees in the Company Newsletter This Holiday SeasonEncourage Employees to Use Their Wellness Benefits Over the HolidaysEmpower HR to Address Economic Uncertainty for Your EmployeesEmployment Law Changes for November 2022RESOURCESVirtual Open Enrollment GuideReturn to Work PlaybookABOUTEngagement PlatformMobile IntranetNewsletter CreationTotal RewardsInternal CommsHuman ResourcesHR BlogFree TemplatesCONTACTAbout UsContact UsHelp CenterRequest a QuoteJob OpeningsPrivacy PolicyPlatform Privacy PolicyFOLLOW US | https://www.backstitch.io/careers?job=1&utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| backstitch | TOTAL COMPENSATIONEMPLOYEE APPINTERNAL NEWSLETTERSBLOGSOLUTIONSSUPPORTCome JoinOur Growing TeamWe’re always looking for talented and passionate team members that want to grow their career at a fast-moving startup building products for the largest employers in their industry.Open Positions inKansas City, MOCome work in the heart of the KC Crossroads District. “2020 Top 10 Startups to Watch: backstitch”- Startland NewsFull-Stack Software EngineerThis role will have you take ownership over future customer-facing products as well as assist in scaling our existing suite of applications.ApplyProduct OwnerThe Product Owner helps ensure our software platform consisting of multiple web and mobile app products meets the needs of the market and the user.This role will require partnering and collaborating closely with multiple teams to collect customer-driven feedback, prioritize the product roadmap, and define software development scope.ApplyUI/UX Designerbackstitch is looking for a forward-thinking UI/UX Designer to help optimize the usability of our software platform consisting of multiple web and mobile app products. This role will require partnering and collaborating closely with multiple teams to plan product direction, collect customer-driven feedback, and define engineering scope.ApplyEnterprise Sales Executivebackstitch is looking for an experienced B2B Software Sales Executive looking to grow their career at a fast growing startup working with some of the most well known companies in the world.This position requires confidence to build relationships and solve challenges for Director, VP and C-suite level executives as you will be responsible for growing revenue across a national territory.Applybackstitch was named as one of:”Kansas City’s Top VC-Backed Companies in 2020″Read Article Benefits We Offer:100% Employer Covered Medical Plan.Flexible Schedule and Uncapped Paid VacationCompany Stock OptionsPerks We Offer:Free Snacks, Coffee, and BeerCasual Office Environment in the KC Crossroads DistrictRegular Company Events and OutingsBrand New 15″ Macbook Pro w/ Touch BarDual 24″ MonitorsiPad w/ Apple PencilStanding Desk Apply Now KANSAS CITY, MO1627 Main St. #1200Kansas City, MO 64108Google Maps Generator by embedgooglemap.netTopics we care aboutHow to Prioritize a Work Environment That Supports EveryoneHow Does Employee Engagement Affect the Employee Experience?Financial Wellness is the Key to Employee EngagementEmployment Law Changes for 2023Help Employees Make the Most of Their Benefits Before the Year EndsEmployment Law Changes for December 2022Celebrate Your Employees in the Company Newsletter This Holiday SeasonEncourage Employees to Use Their Wellness Benefits Over the HolidaysEmpower HR to Address Economic Uncertainty for Your EmployeesEmployment Law Changes for November 2022RESOURCESVirtual Open Enrollment GuideReturn to Work PlaybookABOUTEngagement PlatformMobile IntranetNewsletter CreationTotal RewardsInternal CommsHuman ResourcesHR BlogFree TemplatesCONTACTAbout UsContact UsHelp CenterRequest a QuoteJob OpeningsPrivacy PolicyPlatform Privacy PolicyFOLLOW US | https://www.backstitch.io/careers?job=2&utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| backstitch | TOTAL COMPENSATIONEMPLOYEE APPINTERNAL NEWSLETTERSBLOGSOLUTIONSSUPPORTCome JoinOur Growing TeamWe’re always looking for talented and passionate team members that want to grow their career at a fast-moving startup building products for the largest employers in their industry.Open Positions inKansas City, MOCome work in the heart of the KC Crossroads District. “2020 Top 10 Startups to Watch: backstitch”- Startland NewsFull-Stack Software EngineerThis role will have you take ownership over future customer-facing products as well as assist in scaling our existing suite of applications.ApplyProduct OwnerThe Product Owner helps ensure our software platform consisting of multiple web and mobile app products meets the needs of the market and the user.This role will require partnering and collaborating closely with multiple teams to collect customer-driven feedback, prioritize the product roadmap, and define software development scope.ApplyUI/UX Designerbackstitch is looking for a forward-thinking UI/UX Designer to help optimize the usability of our software platform consisting of multiple web and mobile app products. This role will require partnering and collaborating closely with multiple teams to plan product direction, collect customer-driven feedback, and define engineering scope.ApplyEnterprise Sales Executivebackstitch is looking for an experienced B2B Software Sales Executive looking to grow their career at a fast growing startup working with some of the most well known companies in the world.This position requires confidence to build relationships and solve challenges for Director, VP and C-suite level executives as you will be responsible for growing revenue across a national territory.Applybackstitch was named as one of:”Kansas City’s Top VC-Backed Companies in 2020″Read Article Benefits We Offer:100% Employer Covered Medical Plan.Flexible Schedule and Uncapped Paid VacationCompany Stock OptionsPerks We Offer:Free Snacks, Coffee, and BeerCasual Office Environment in the KC Crossroads DistrictRegular Company Events and OutingsBrand New 15″ Macbook Pro w/ Touch BarDual 24″ MonitorsiPad w/ Apple PencilStanding Desk Apply Now KANSAS CITY, MO1627 Main St. #1200Kansas City, MO 64108Google Maps Generator by embedgooglemap.netTopics we care aboutHow to Prioritize a Work Environment That Supports EveryoneHow Does Employee Engagement Affect the Employee Experience?Financial Wellness is the Key to Employee EngagementEmployment Law Changes for 2023Help Employees Make the Most of Their Benefits Before the Year EndsEmployment Law Changes for December 2022Celebrate Your Employees in the Company Newsletter This Holiday SeasonEncourage Employees to Use Their Wellness Benefits Over the HolidaysEmpower HR to Address Economic Uncertainty for Your EmployeesEmployment Law Changes for November 2022RESOURCESVirtual Open Enrollment GuideReturn to Work PlaybookABOUTEngagement PlatformMobile IntranetNewsletter CreationTotal RewardsInternal CommsHuman ResourcesHR BlogFree TemplatesCONTACTAbout UsContact UsHelp CenterRequest a QuoteJob OpeningsPrivacy PolicyPlatform Privacy PolicyFOLLOW US | https://www.backstitch.io/careers?job=5&utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Automation Intellect | BenefitsReduce ChangeoverImprove PerformanceIncrease RevenueReduce DowntimeIncrease ThroughputPlatformFeaturesSecurityImplementationServicesResourcesNewsBlogVideosCase StudiesAbout UsLeadershipCareersROI CalculatorRequest a DemoThis listing has expiredQuick LinksAbout UsBenefitsPlatformServicesResourcesNewsContact Info11435 Granite StreetCharlotte, NC 28273+1 [email protected]© 2022 Automation Intellect. All rights reserved. | https://automationintellect.com/?post_type=job_listing&p=9139&utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Tava Health | | https://apply.workable.com/tava-health/j/CDBA980CD3?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Clearbox Decisions dba Cloverpop | Skip to contentSOLUTIONCUSTOMERSTHOUGHT LEADERSHIPCOMPANYLOGINSCHEDULE A DEMOCome Join Us!Clearbox Decisions Inc, the company behind Cloverpop,is on a mission to transform business decision-making.Each year, hundreds of billions of dollars and millions of hours are lost or wasted because of bad decisions. We’re here to fix that. Through our software platform and decision services, we provide enterprise clients with solutions to structure, collaborate, automate and learn from decisions. We focus primarily on marketing, sales and strategy decision areas. Thanks to our proven technology and process, we remove human biases, increase stakeholder buy-in and drive decision speed and quality.We are a venture backed start-up led by experienced entrepreneurs and thought leaders in the space of behavioral science, AI and the future of work. Our clients include Fortune 100 companies in the consumer goods, pharmaceutical and technology industries.Clearbox Decisions Inc (CLX) is proud to be an Equal Employment Opportunity and affirmative action employer. We celebrate diversity and do not discriminate based on race, religion, color, national origin, sex, sexual orientation, age, veteran status, disability status, or any other applicable characteristics protected by law.Career OpportunitiesMarketing LeadDecision making can be a broad, abstract topic. We are looking for an expert communicator that can drive Clearbox Decision’s efforts in educating potential clients and more broadly, business leaders, on the importance of effectively managing the decision process, the impact and how our Cloverpop platform can drive those results. In this role you will develop and drive our company’s marketing strategy. This will include coordinating the development and deployment of thought leadership articles, podcasts, webinars, marketing collateral and advertising tactics. You will manage our top-of-funnel pipeline, driving awareness and converting to qualified sales leads.How you will grow:This position will give a driven, ambitious marketer the opportunity to shape the marketing function at Clearbox Decisions. In addition to driving strategy, establishing the infrastructure, you will be responsible for building out the marketing team as we grow as a company. You will be working directly with our advisors and clients who are senior level executives at leading companies; this will provide a unique learning and networking opportunity.Responsibilities:Develop our marketing strategy, ensure it is aligned with overall business strategy and objectivesTranslating marketing strategy into a tactical plan and calendarOwn the tactical plan, directing and coordinating the marketing effortsWork with leadership team to define marketing budgets and defining ROI measurementsWork with our leadership team, advisors to support developing thought leadership contentManage and build-on our existing marketing tech platform (primarily Hubspot)Maintain our various marketing channels, overseeing social media marketing strategy,content marketing and websiteDevelop, manage and measure advertising campaignsHire, mentor and grow marketing teamSupport sales and lead generation effortsSkills and Qualifications:Bachelor’s degree in business, marketing, communications, or related field.5+ years working in marketing at a B2B software companyProven experience developing marketing strategy and executing marketing campaignsEffective time management skills and the ability to multitaskExcellent interpersonal, written and oral communication skills.Strong copywriting skillsProven ability to manage budgetsProactive work ethic with a bias towards actionHigh competence in project and stakeholder management.Experience with digital marketing forms such as social media marketing and contentmarketingExperience in marketing automation platforms such as Hubspot, Salesforce, etc…Competency in Microsoft applications including Word, Excel, and Outlook.Benefits:Competitive Salary + EquityUnlimited PTORemote work OKHealth insurance (vision and dental) and 401KSenior level exposureMarketing Lead – Apply BelowFirst name*Last name*Email*Upload Resume*Director of Finance & OperationsOverview: Level: Senior Level (Member of the leadership team)Date: December 2022 Location: Chicago, IL Reporting To: Chief Executive Officer Clearbox Decisions, Inc., creators of the Cloverpop Decision Intelligence platform is transforming enterprise decision-making. Each year, tens of billions of dollars are lost or wasted because of bad decisions, and we’re here to fix that. Through our software platform, Cloverpop (www.cloverpop.com), we bring together the “art” and “science” of decision making by provide enterprise customers with the ability to automate, collaborate, track, and learn from decisions. Thanks to our proven technology and process, we bridge the data to decision disconnect, remove human biases, increase stakeholder buy in and drive decision speed and quality. We are a venture backed start-up led by experienced entrepreneurs and thought leaders in the space of decision intelligence, behavioral science, AI, and the future of work. Our clients include Fortune 100 companies in the consumer goods, pharmaceutical and technology industries. Role Description: As the Director of Finance and Operations, you will play an integral role within the organization, establishing and leading the finance function and scaling up critical operations across the company including HR, Strategic Planning, etc… This position will work closely with the executive leadership team as well as the board of directors and our investors. You’re Impact: As the Director of Finance and Operations, you will be the founder of our organizations finance and operations functions. The processes and reporting capabilities you will establish will be critical to the organizations strategic planning, decision-making and realization of our long-term vision. The capabilities you build will help shape and define our go-to-market strategy, ways of working and talent strategy. Responsibilities: Strategic: Advise CEO on topics related to strategy development, opportunities to increase shareholder value, deploy and conserve capital and mitigate our operational riskRepresent the organizations Finance, HR and Operations interests in leadership team deliberationsOwn budgeting, financial planning and long-range strategic modelingPartner with CEO on investor relations and lead reporting activities including materials required for board meetingsCoordinate, prepare and review monthly, quarterly and annual company performance reporting Finance & Accounting: Direct all aspects of accounting operations, overseeing all transactions related to general ledger, receivables, payables, payroll and financial reportingDevelop accounting policies and ensure records are maintained in accordance with generally accepted accounting principles.Own all budgeting, forecasting and annual auditsOversee all aspects of accounting and tax policyOversee and execute all aspects of contract-to-invoice, AR and APHandle all company insurance matters to ensure complianceOversee all full-time and contracted personnel related to function(s), including but not limited to contracted bookkeeper, Insurance Agent, Tax advisor, etc.Manage all equity / options issuances, ensuring they are accurate and up to date through our equity management platform, CartaCommercial:Participate closely in contract pricing, negotiations, and related commercial decisionsWork with Commercial and Product teams to develop optimal pricing strategy for existing and new offeringsEnsure MSA’s and other related agreements are in place and up to dateWork with Sales and Decision Success team to translate high level forecasts to account plansOwn and drive gross margins through understanding and effective management of COGSOversee bookings and ARR regarding policy, consistency and accuracyManage and execute commissions in partnership with leadershipAdvise leadership on potential partnership opportunities, assessing potential commercial value, risks, and opportunities for success HR: Oversee all aspects of HR, including implementation and execution of company policy, compensation and recruiting strategyEstablish CLX compensation strategy, defining level and pay-bands across various functionsManage new-resource approval process and support hiring managers in processEstablish new hire on-boarding process, periodic performance reviews, employee engagement monitoring and exit processParticipate if/where needed in personnel matters that may ariseLead recruitment of HR lead once appropriate Skills and Qualifications: An accounting designation and/or Master’s degree in Accounting, Finance or Business Administration/Commerce5-7+ years of progressively responsible experience in financial managementExperience working in a growing start-up environment strongly preferredExperience in SaaS software, Analytics / AI, is a huge plusProblem solving and recommendation development – You will need to have a fine-tuned ability to lead a structured problem-solving process that results in concrete business recommendationsStrong communication skills – you will be working directly with executive leadership, investors and at times, customers; effective communication will be critical, well-structured e-mails, presentation skills, consistent and timely follow up will all play a critical role to your success. Solution knowledge – You will need to spend time understanding all elements of our product offering and how they drive value for our clients. Benefits: Competitive SalaryEquity Stock OptionsUnlimited PTORemote work OKHealth insurance (vision and dental) and 401KDirector of Finance and Operations – Apply BelowFirst name*Last name*Email*Upload Resume*SolutionDecision PlatformD-SightDecision ServicesCustomersCustomersBlogSearchCompanyAbout UsCareersContact UsPrivacy Policy • Terms • Microsoft Teams & Slack Security© 2021 ClearBox Decisions, Inc. All Rights Reserved.website by inv8.com • background vectors created by iconicbestiary | https://www.cloverpop.com/careers/?job=2&utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| ANRA Technologies | HOME COMPANY TECHNOLOGY SOLUTIONS NEWSSearch for: HOME | SR. IOS MOBILE DEVELOPERPosted on March 1, 2023 by Leida MejiaFull TimeNew DelhiPosted 3 weeks agoWebsiteANRA TechnologiesANRA Technologies is looking for a Mobile Application Architect with experience in native mobile applications. Experience in Android and iOS is highly desirable, although iOS is preferred.About ANRAANRA Technologies, with offices in Washington DC, London, New Delhi and Estonia, is an international provider of drone operations and traffic management solutions for unmanned aircraft systems (UAS) operators and airspace managers. We offer intelligent Machine Learning and AI driven traffic management software capabilities for UAS Traffic Management (UTM) and Urban Air Mobility (UAM) operations.Required CapabilitiesCompetent at Swift – e.g. can design and work with protocol-oriented programming.Develop Android mobile applications.Strong knowledge of Android SDK, different versions of Android, and how to deal with different screen sizes.Competent-to- expert at git (able to check in, merge, branch, tag without causing problems for other developers).Writing reusable, testable, and efficient code.Integrate mobile applications with back-end RESTful servicesIdentify, troubleshoot and resolve issues and defects through collaboration and monitoring application performanceParticipate and provide subject matter expertise in mobile product design.Establish procedures and best practices for consumer mobile application development practice.Collaborate with analysts, designers, and system owners in the testing of new software programs and applications.Learning new technologies when required.Competent at XCode configuration management.Swift , Objective-C., git, Android , native APIs , native SDKs , Application Development.QualificationsA Bachelor’s degree (in Computer Science or equivalent)5+ years of application development for native Android and IOS applications.Familiar with Agile methods like Jira, Bitbucket.Self-confidence, flexibility and a result driven attitudePositive attitude with a willingness to help team members and provide excellent customer service to clientsPosted inSYSTEMS ENGINEERSTRATEGY AND BUSINESS DEVELOPMENT MANAGER WITH DRONE/AEROSPACE EXPERIENCEANRA TECHNOLOGIES © 2023. Privacy Policy▼Keep up with our Latest News We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy | https://www.anratechnologies.com/home/job/sr-ios-mobile-developer/?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Jurny | ProductsCompanyResourcesOwner LoginHome Careers JobsJurny JobsAt Jurny our mission has always been to create seamless experiences through technology for our guests, partners, and employees.3Position Team Location Social Media Manager Marketing Remote READ MOREClient Onboarding Manager Operations Remote READ MOREMarketing Intern Marketing USA READ MORESubmit all Applications to [email protected]@jurny.comSUPPORT+1 [email protected] YOUR JURNYPrivacy policy Cookie policy@ Jurny Inc. 2022. All Rights ReservedDownload Jurny App | https://www.jurny.com/jobs?job=1&utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Jurny | ProductsCompanyResourcesOwner LoginHome Careers JobsJurny JobsAt Jurny our mission has always been to create seamless experiences through technology for our guests, partners, and employees.3Position Team Location Social Media Manager Marketing Remote READ MOREClient Onboarding Manager Operations Remote READ MOREMarketing Intern Marketing USA READ MORESubmit all Applications to [email protected]@jurny.comSUPPORT+1 [email protected] YOUR JURNYPrivacy policy Cookie policy@ Jurny Inc. 2022. All Rights ReservedDownload Jurny App | https://www.jurny.com/jobs?job=2&utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Jurny | ProductsCompanyResourcesOwner LoginHome Careers JobsJurny JobsAt Jurny our mission has always been to create seamless experiences through technology for our guests, partners, and employees.3Position Team Location Social Media Manager Marketing Remote READ MOREClient Onboarding Manager Operations Remote READ MOREMarketing Intern Marketing USA READ MORESubmit all Applications to [email protected]@jurny.comSUPPORT+1 [email protected] YOUR JURNYPrivacy policy Cookie policy@ Jurny Inc. 2022. All Rights ReservedDownload Jurny App | https://www.jurny.com/jobs?job=3&utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Idelic | Sorry, we couldn’t find anything hereThe job posting you’re looking for might have closed, or it has been removed. (404 error).Jobs powered by | https://jobs.lever.co/idelic/0c7c49ef-2a1d-458c-a980-a037e5fae6b4?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Tava Health | OVERVIEWAPPLICATIONShare this job Apply for this job | https://apply.workable.com/tava-health/j/4A08CCB53E?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Cloverly | Skip to main contentLinkedInJoin LinkedInEmailPassword (8+ characters)By clicking Agree & Join, you agree to the LinkedIn User Agreement, Privacy Policy, and Cookie Policy.Agree & JoinAlready on Linkedin? Sign inOn LinkedIn, applicants are 4X more likely to get hired through their network | https://www.linkedin.com/jobs/view/choose-your-own-adventure-at-cloverly-3330554115?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| BeMo Corp | Share:Director of ProductREMOTE$187,210 AnnuallyApply for this positionBack to JobsThe Director of Product is responsible for leading the overall strategy, vision, and direction of BEMO Product Offerings and SaaS applications. This includes overseeing new products from conception to launch and each new iteration. S/he will be the point person throughout the entire product lifecycle, from the product strategy phase to the go-to-market phase. S/he will develop a product roadmap for the entire product team, ensure seamless product functionality, decide on backlog prioritization, and lead the product from vision to completion. In addition, the Director of Product will collaborate with product management to align the product roadmap to go-to-market messaging.The Director of Product will demonstrate the ability to:Lead the product organization.Be accountable for the end-to-end product experience, product management, and design teams.Work on product strategy for both short and long-term outcomes.Guide teams with numerous products at different phases in the product lifecycle.Talk with customers to gain additional insights about their businesses.Work with engineering and design teams to develop new features.Work with marketing, sales, and customer success to launch a new product.Understand what is happening in the market, industry, or on a topic the team is considering for the product roadmap.At BEMO, the Director of Product (MGR7) will:Lead the Product resources organization.Be responsible for creating and controlling department planning, staffing, budgeting, and expense priorities.Propose and execute modifications to enhance our products’ strategies and procedures.Collaborate with senior management to establish strategic plans and objectives and possess technical or domain expertise in multiple areas and breadth across departmental areas.Have extensive expertise in various Product Development and Product Management, as well as a broad understanding of the commercial implications of Product Management within the broader context of the organization.Align the department’s vision and strategy with BEMO’s strategy and goals, oversee department operations to prevent failures and replicate successes, and strategically plan to grow and develop the department’s people and processes.Participate in creating methods, techniques, and evaluation criteria and ensures budgets and schedules are met while designing department structures and headcount plans.Be able to break down complex product-related problems into solutions by using their own expertise and involving the appropriate stakeholders in decision-making.Foster a culture of transparent, open, and audience-oriented communication throughout the organization that guides internal conversations about the direction of the Products department and actively contributes to significant areas and aspects of the organization.Be a positive role model for leadership within the Products department and coach and mentor managers within and in other departments.Be able to speak on behalf of the Products department externally, representing the department’s interests and goals to external stakeholders.Work closely with the Leadership Team, other managers, and stakeholders to align priorities and organizational goals with the Products function.Demonstrate deep competency and expertise in the field by educating the organization on Products-related matters at both a macro level (through organization-wide events) and a micro level (through team-specific training).Responsibilities & Primary Goals:Create a Product StrategyThe foundation of a great product is a solid strategy, and the BEMO Director of Product is responsible for it.Create a strategy outline, circulate it around the primary stakeholders, flesh it out with their feedback, and make it the basis of customer success.Ensure each stage is completed and each new feature is implemented as planned and within the deadline.Conduct Market ResearchThe B2B SaaS business model depends on extensive market research to succeed. This is due to the ever-changing product-market fit metrics and customer demands. S/he will create a list of market research parameters and work with our Product Marketing Manager to drive the research and report the results.Generate Product IdeasThe Director of Product would assemble a brainstorming team consisting of stakeholders from each department involved with the product to generate creative ideas based on the results of the market research.Oversee Product DesignThe Director of Product will inherently focus on the development and product design.S/he will have to brainstorm design elements during the idea generation phase, analyze customer feedback on previous iterations or competitor products, and finalize a design to be implemented.Collaborate and Coordinate with Other DepartmentsS/he will collaborate with several BEMO departments, all of which collaborate and work together to build a better product and achieve early delivery to it.As the Director of Product, you will often be the center point for collaborations, with each department referring to you for guidance and coordination.As BEMO adheres to DevOps principles, you will be responsible for implementing them on the product side.Cultivate Relationships with CustomersThe Director of Product will interact with our best customers to gather their feedback on potential new and existing features and review future roadmaps.S/he will enroll our best customers in the preview deployment of our early product versions.The Director of Product will validate scenarios back on their feedback.Keep Major Stakeholders InformedAct as a strategic partner to the leadership team by providing guidance and support on product-related matters.Need to keep BEMO’s leadership informed at various points in the product life cycle, such as:When creating the product strategyWhen finalizing the list of features and pricingBefore and after testing the productDuring the review period after its launchImplement a Streamlined Product Launch with Marketing coordinationThe Director of Product will drive BEMO’s product launches and decide how the broader customer base reacts and interacts with the product.S/he will work to streamline our product launch by delivering a product launch strategy and roadmap and coordinating with all our internal teams (Sales, Marketing, Operations, and Customer Success).Requirements:7+ years of progressive product management experience, including leading cross-functional teams and launching successful products.Strong leadership and management skills, with the ability to inspire and motivate a team.Excellent communication and interpersonal skills, including the ability to articulate complex product concepts to technical and non-technical stakeholders, internally and externally.Deep understanding of product development methodologies, including Agile, Lean, and Waterfall.Strong analytical and problem-solving skills, with the ability to make data-driven decisions.Understanding of market and customer needs, with the ability to use customer insights to inform product development.Strong strategic thinking and planning skills, with the ability to develop and execute a long-term product vision.A track record of delivering successful products on time and within budget.Familiarity with tools and technologies, such as project management software, customer feedback platforms, and data analytics tools.Specialized Knowledge or Skills Preferred:A bachelor’s or master’s degree in computer science, engineering or a related field.Software development experience as a developer or manager.Possess inspirational leadership and entrepreneurship qualities.High-level motivational and leadership skills to manage virtual teams.Sound knowledge and thorough understanding of business and technology.Marketing Product Management experience a plus.Experience working with small and medium-sized organizations a plus.A Microsoft Certification MS-900 or SC-900 a plus.US Benefits:4 weeks (20 days) PTO 11 Paid Holidays 3-month paid sabbatical every 5 years 12-weeks paid parental leave Unlimited Sick days Medical, Dental, Vision, and Life Insurance 401k, 80% match on first 5% of contributions $500 home office setup (in addition to company provided computer) 100% remote (we’ve been remote since day 1) BEMO participates in the E-Verify program.https://www.e-verify.gov/sites/default/files/everify/posters/IER_RighttoWorkPoster.pdf Apply for this positionGet UpdatesAre you interested in hearing about new opportunities at BEMO in real time? Enter your email address to be notified automatically when new positions are posted.sendPowered by Rippling ATS © 2023ADMIN LOGIN | SUBSCRIBE VIA RSS | https://bemo.rippling-ats.com/job/559391/director-of-product?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Chargezoom | Software EngineeringScrum Master (NOT REMOTE)Irvine, CaliforniaWork Type: Full TimeApply NowWe are looking for a Scrum Master that wants to work in our amazing offices – Check it out – https://www.builtinla.com/company/chargezoomChargezoom is a rapidly growing FinTech startup and in addition to the usual perks (excellent pay, great benefits, ESOP, stocked kitchen, catered meals, etc.) we are offering a place for Devs to grow their skills and have room for career growth.This position is for a Scrum Master AKA “Supreme Master of Boards” (NO REMOTE), you will serve as a facilitator for the engineering and development teams. You will be responsible for translating and understanding the big picture for each dev and overseeing sprint organization and execution.What you will do…Works closely with the Product Owner to translate epics, stories, and other sprint items into actionable tasks.You must have a solid understanding of the purpose and implications behind each initiative. Create and Manage Tickets on our Jira Board.Manage, assign and delegates tasks.Ensuring the developer team’s work aligns with big-picture priorities and schedules.Create/Manage “ETA” reports based on the usage of our resources.What you bring to the table…Solid Understanding of Scrum Workflow and Methodology.Managing the process and moving the project toward completion. A problem-solving mindset.5+ years of experience as Scrum Master or similar role.3+ working and managing DevelopersHelping the team agree on what is achievable during each development sprint.Track, identify and overcome blockers, and manage Jira artifacts.Assisting the team to make progress by ensuring each person is working on the right tasks.Supporting the Engineering team by managing Jira boards and cards.Ensuring Jira and Knowledge Base Articles are comprehensive and accurate; including contributing to documentation during times when engineering is fully deployed.Ability to work independently as well as part of a team.Strong verbal and written skills.Excellent people and project management skills.Nice to have…Bachelor’s degree in computer science, information technology, or relevant field preferred.Certified Scrum Master, SAFe preferred.Ability to work in a fast-paced, high energy startup environmentWhat’s in it for you…Competitive salary.Equity/stock options in a rapidly growing company.Great medical coverage.Fully-stocked snack bar & weekly catered lunches.Company-sponsored outings and weekend retreats.Ability to mold your career and make an immediate impact.Work in a fast-paced, fun environment with an awesome group of people from all over the world.Compensation: $90K – 110KJob Type: Full Time – In OfficeJob Location: Irvine, CAOpenings: 2 | https://chargezoom.freshteam.com/jobs/CvHmnJ6RQCua/scrum-master-not-remote?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Courier | Developer AdvocateSAN FRANCISCO OR REMOTE /MARKETING /FULL TIME/ HYBRID APPLY FOR THIS JOBAt Courier, we are on a mission to make software-to-human communication delightful.Courier is doing for notifications what Stripe did for payments, making it easy for developers to build and manage notifications infrastructure for mobile and web apps. We’ve combined a powerful API with a web-based design studio that lets teams create automated product-triggered notifications that deliver the right message to the right user at the right time over email, Push, Slack, SMS—you name it. Backed by top-tier investors including Google Ventures, Bessemer Venture Partners, Matrix Partners, Twilio, SendGrid, Slack, and Y Combinator, our goal is to build a platform that developers don’t just use but one that they love. If you want to push the frontier in developer tooling, we want to work with you. We’re solving a complex and tedious problem for developers: product notification infrastructure. Companies like LinkedIn, Slack, and GitHub dedicate large engineering teams and tens of millions of dollars per year to building and maintaining the systems that power their user notifications, alerts, reminders, digests, and other programmatic communication. With Courier, the next generation of startups will be able to dedicate those resources to delivering customer value rather than reinventing the wheel.Our Developer Relations team will be responsible for engaging with the developer community to educate them on how Courier can help them accomplish more with less. This may include social engagement, events, workshops, guides, example apps, and more.Notes for CandidatesSalary: $150k-$190k, dependent on experience; + equityLocation: This role is flexible – work from home or our office in the SoMa neighborhood of San Francisco, whatever you prefer. Preference will be given to candidates who can be in San Francisco for the Marketing team’s monthly on-sites.Visas: Courier cannot apply for new visas for candidates but can transfer existing visas (please allow up to 8 weeks for the transfer after an offer letter is signed.)Interested in a little additional reading on Courier and what we are up to or what we value? Check out our latest content.What You’ll DoBe an outspoken advocate in the developer community for Courier, participating wherever our audience congregates (social network communities, conferences, meetups, hackathons, etc).Create content that helps developers solve problems – from writing technical guides to speaking at events and on live streamsIdentify key partners in the platform engineering team’s tech stack that are used with Courier. Work with their DevRel teams to create content, enable the developer community, and drive integration requirements with the engineering team. Work with product, engineering, sales, and marketing to ensure that the Developer Relations strategy aligns with broader business goalsWho You Are3+ years experience in Developer RelationsGreat story teller: able to show the value of a product through using itBuilder: Experience with programming languages such as Python and Node.jsActive in the Developer Community: you have a strong following and a reputation in the community for helping other developers move their projects forward.Customer Centric: You are passionate about making the software development process betterDriven: You’re able to prioritize, problem solve, multi-task, and work independently in a dynamic, rapidly changing workplace and industryOur Values• Zoom Out: Don’t just stay in your lane. Take the blinders off and look at the entire business.• Keep It Real: Be honest about what is going well and what isn’t. Celebrate wins and have hard conversations.• Talk To Customers: Working with developers isn’t a job role here – it is something we all need to do. Hop on a Zoom, reach out in Slack, and build a relationship.• Have An Opinion: Each team member is an expert on what success will look like for Courier. Nobody else has the answers.• JFDI: There will always be more work to do than people to do it. If you see something that needs to get done, just f*cking do it. Don’t wait for someone else.Diversity, Equity & InclusionAt Courier, we believe that our diverse perspectives are our biggest strengths — and that embracing them will create real change in how software communicates with humans. As an equal opportunity employer, we are committed to building an inclusive environment where you can be you. Please don’t hesitate to ask if we can accommodate you in any way, both during the interview process and after.Benefits• Top of market salary• Generous equity plan• Top of the line health insurance plan (medical, dental & vision) covered 100% for both you and your dependents• 401k through Vestwell• Flexible health spending account including $500 employer contribution• Unlimited paid time off (1 week per quarter required)• $100 monthly wellness stipend• 12 covered therapy sessions per year through Samata Health• A brand new workstation and credit card to cover any other necessary expenses• Free lunch in the office, DashPass covered, and $25 DoorDash credit on Fridays• $2000 annual personal development budget• $100 monthly commuter benefit contribution• Other perks and discounts through SequoiaSecurity & ComplianceCourier takes protecting our customers’ data – and of their notification recipients – seriously. Every Courier employee goes through security training and a background check as part of onboarding. Each employee is expected to follow Courier’s security and compliance processes and uphold industry best practices.APPLY FOR THIS JOBCourier Home PageJobs powered by | https://jobs.lever.co/trycourier/9653bac6-0be5-4905-96db-c3f88f670273?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Cloverly | Skip to main contentLinkedInJobsDismissDismissJoin nowSign inAutomation & Digital Marketing ManagerCloverly Atlanta, GA1 month ago Be among the first 25 applicants See who Cloverly has hired for this roleApply SaveAUTOMATION AND DIGITAL MARKETING MANAGERAbout Cloverly:To make meaningful progress in the fight against climate change, businesses must accelerate the decarbonization of their operations. Today, some emissions are truly unavoidable. This is where Cloverly fits in. Cloverly connects suppliers of carbon removals and offsets with the companies and consumers who want to take action now.Cloverly is a platform for climate action, with a marketplace for carbon removals. As the first API in the world for carbon credits, Cloverly is in a leadership position in building a new industry that the world deeply needs. This person will play a pivotal role in helping direct investment into carbon removal technologies and other high-quality projects that help us reach our climate goals.As Cloverly grows, we are seeking an Automation & Digital Marketing Manager to both own the optimization of the associated martech stack and to leverage those technologies to create world-class campaigns to support all phases of the funnel. This will be a continuous test and refine effort that requires advanced analytic skills to drive a sustainable and scalable marketing automation engine. Experience with HubSpot is a must; technical/enterprise B2B sales, account-based marketing methodologies is highly preferred.What You Will Do:Design, plan, manage, and optimize automation campaigns across the entire funnel to ultimately generate revenueSet the short and long-term vision for the continuous evolution of how automation & digital can enrich the entire customer journey, from prospecting to post-transaction enablement, developing a strategy and roadmap to deliver the visionPlan and execute all web, SEO/SEM, database marketing, email, and display advertising campaignsOwn the performance, evolution, and optimization of the website, including landing page testing/optimization and partnering with other stakeholders to showcase new multimedia content that optimizes the user experience and establishes Cloverly as a thought leaderMeasure and report on the success of automation campaignsCurate, maintain, optimize, and evolve a sophisticated martech stack that supports the GTM growth objectivesUtilize strong analytical ability to evaluate end-to-end customer experience across multiple channels and customer touch pointsIdentifies critical conversion points and drop off points and optimizes user funnelsCollaborates with agencies and other vendor partnersUse data insights to recommend, implement, and test continuous automation, digital, and website performance improvementsBe a steward of marketing data, creating and enforcing data governance best practices in partnership with other GTM teamsCreate impactful nurture programs to improve conversion rates from leads to opportunitiesCreate engaging success and expansion programs to increase the breadth and depth of current relationshipsCollaborate with other departments, such as sales, product, and customer service, to leverage and support all GTM internal and external stakeholdersWorking closely with the Vice President of Marketing for granular tracking, reporting, and efficient lead management in the handoff from marketing to salesOversee vendor selection and contracts as neededMonitor industry trends and stay up-to-date on new technologies and techniquesAct as a steward of process adherence, best practice, and continuous improvementYou Might Be A Fit If You Have:8+ years of experience in B2B growth automationExperience at early-stage SaaS companies, with a focus on enterprise salesExperience using HubSpot for multichannel campaign performance trackingManaged the execution of automation campaigns for multiple verticals, personas, and funnel stagesIntegrate automation into tailored customer journeys that span GTM teams and channelsOversaw the budget and ROI tracking for martech stacks and associated campaignsStrong analytical skills, with experience analyzing data and making data-driven decisionsKnowledge of sales techniques and strategiesExcellent communication and collaboration skillsAbility to prioritize and manage multiple tasks and projectsStrong problem-solving and decision-making skillsFlexibility and adaptability to changeA desire to learn and grow in the demand generation fieldWhat Makes Cloverly Exciting:Get to work on an important mission that truly makes a differenceTremendous company outlook where you will have limitless opportunitiesAwesome culture (see section About Cloverly) where you will be empowered, make an impact, learn a ton, grow rapidly, and genuinely enjoy yourself and your teammatesMeaningful equityRemote-friendlyOpen time-off policyThis is a rare opportunity to make a big impact, join a hyper growth company, and be part of an incredible team and culture. Cloverly is a collaborative, transparent, no-politics, no-ego, well funded team of startup veterans who have built unicorns such as Pendo and FullStory.We are committed to creating inclusive teams that foster a genuine workplace culture and a sense of belonging for each and every employee. We encourage everyone to apply.Cloverly provides equal employment opportunities (EEO) to all employees and applicants for employment without regard to race, color, religion, sex, national origin, disability, genetics, gender, sexual orientation, age, marital status, veteran status. In addition to federal law requirements, Cloverly complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities. This policy applies to all terms and conditions of employment, including recruiting, hiring, placement, promotion, termination, layoff, recall, transfer, leaves of absence, compensation, and training.Show more Seniority levelMid-Senior levelEmployment typeFull-timeJob functionMarketing and SalesIndustriesTechnology, Information and Internet Referrals increase your chances of interviewing at Cloverly by 2xSee who you knowGet notified about new Digital Marketing Manager jobs in Atlanta, GA.Sign in to create job alertSimilar jobsMedical DirectorMedical DirectorNeuroglee TherapeuticsBoston, MA7 minutes agoLicensed Insurance Agent – Avg $120k First YearLicensed Insurance Agent – Avg $120k First YearInsurTech AdvisorsUnited StatesJust nowFinance ManagerFinance ManagerApeiron BioenergyPathum Thani, Thailand10 minutes agoCRNA Casual Part Time – Alfred I duPont HospitalCRNA Casual Part Time – Alfred I duPont HospitalNemoursWilmington, DE1 minute agoVape Sales Representative in Europe and the USVape Sales Representative in Europe and the USHiredChina.com 为中国企业链接国际人才Hauts-de-France, France7 minutes agoFinance ManagerFinance ManagerAnjun BrasilSão Paulo, São Paulo, Brazil13 minutes agoShow more jobs like this People also viewedMedia ExecutiveMedia ExecutiveZenithHong Kong, Hong Kong SAR3 minutes agoTransportation Department SupervisorTransportation Department SupervisorRightPro StaffingSt Albans, VT5 minutes agoFranchise OwnerFranchise OwnerChick-fil-A Corporate Support CenterSalt Lake City, UT13 minutes agoCommunity Loan OfficerCommunity Loan OfficerRegions BankAtlanta, GA3 minutes agoSenior Comptable – PSF Grandissante, Service Sur-MesureSenior Comptable – PSF Grandissante, Service Sur-MesureAbiomis LuxembourgLuxembourg, Luxembourg, Luxembourg3 minutes agoLaboratory TechnicianLaboratory TechnicianFulton HoganMackay, Queensland, Australia11 minutes ago(Senior) Account Manager, eLearning Sales(Senior) Account Manager, eLearning SalesHKT HomeHong Kong, Hong Kong SAR2 minutes agoHuman Resources OfficerHuman Resources OfficerAusGroup – AGC | MASPerth, Western Australia, Australia12 minutes agoCustomer Support SpecialistCustomer Support SpecialistCrown Equipment Pty Ltd – AustraliaBrisbane, Queensland, Australia1 minute agoSenior Mining Engineer – JundeeSenior Mining Engineer – JundeeNorthern Star Resources LimitedPerth, Western Australia, Australia2 minutes agoLooking for a job?Visit the Career Advice Hub to see tips on interviewing and resume writing.View Career Advice HubLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyYour California Privacy ChoicesCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/jobs/view/automation-digital-marketing-manager-at-cloverly-3514134182?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Cloverly | Skip to main contentLinkedInJobsDismissDismissJoin nowSign inAutomation & Digital Marketing ManagerCloverly United States1 week ago 82 applicants See who Cloverly has hired for this roleApply SaveDirect message the job poster from CloverlyShayla W.Lead Recruiter @ Cloverly – we’re hiring!AUTOMATION AND DIGITAL MARKETING MANAGERAbout Cloverly:To make meaningful progress in the fight against climate change, businesses must accelerate the decarbonization of their operations. Today, some emissions are truly unavoidable. This is where Cloverly fits in. Cloverly connects suppliers of carbon removals and offsets with the companies and consumers who want to take action now.Cloverly is a platform for climate action, with a marketplace for carbon removals. As the first API in the world for carbon credits, Cloverly is in a leadership position in building a new industry that the world deeply needs. This person will play a pivotal role in helping direct investment into carbon removal technologies and other high-quality projects that help us reach our climate goals.As Cloverly grows, we are seeking an Automation & Digital Marketing Manager to both own the optimization of the associated martech stack and to leverage those technologies to create world-class campaigns to support all phases of the funnel. This will be a continuous test and refine effort that requires advanced analytic skills to drive a sustainable and scalable marketing automation engine. Experience with HubSpot is a must; technical/enterprise B2B sales, account-based marketing methodologies is highly preferred.What You Will Do:Design, plan, manage, and optimize automation campaigns across the entire funnel to ultimately generate revenueSet the short and long-term vision for the continuous evolution of how automation & digital can enrich the entire customer journey, from prospecting to post-transaction enablement, developing a strategy and roadmap to deliver the visionPlan and execute all web, SEO/SEM, database marketing, email, and display advertising campaignsOwn the performance, evolution, and optimization of the website, including landing page testing/optimization and partnering with other stakeholders to showcase new multimedia content that optimizes the user experience and establishes Cloverly as a thought leaderMeasure and report on the success of automation campaignsCurate, maintain, optimize, and evolve a sophisticated martech stack that supports the GTM growth objectivesUtilize strong analytical ability to evaluate end-to-end customer experience across multiple channels and customer touch pointsIdentifies critical conversion points and drop off points and optimizes user funnelsCollaborates with agencies and other vendor partnersUse data insights to recommend, implement, and test continuous automation, digital, and website performance improvementsBe a steward of marketing data, creating and enforcing data governance best practices in partnership with other GTM teamsCreate impactful nurture programs to improve conversion rates from leads to opportunitiesCreate engaging success and expansion programs to increase the breadth and depth of current relationshipsCollaborate with other departments, such as sales, product, and customer service, to leverage and support all GTM internal and external stakeholdersWorking closely with the Vice President of Marketing for granular tracking, reporting, and efficient lead management in the handoff from marketing to salesOversee vendor selection and contracts as neededMonitor industry trends and stay up-to-date on new technologies and techniquesAct as a steward of process adherence, best practice, and continuous improvementYou Might Be A Fit If You Have:8+ years of experience in B2B growth automationExperience at early-stage SaaS companies, with a focus on enterprise salesExperience using HubSpot for multichannel campaign performance trackingManaged the execution of automation campaigns for multiple verticals, personas, and funnel stagesIntegrate automation into tailored customer journeys that span GTM teams and channelsOversaw the budget and ROI tracking for martech stacks and associated campaignsStrong analytical skills, with experience analyzing data and making data-driven decisionsKnowledge of sales techniques and strategiesExcellent communication and collaboration skillsAbility to prioritize and manage multiple tasks and projectsStrong problem-solving and decision-making skillsFlexibility and adaptability to changeA desire to learn and grow in the demand generation fieldWhat Makes Cloverly Exciting:Get to work on an important mission that truly makes a differenceTremendous company outlook where you will have limitless opportunitiesAwesome culture (see section About Cloverly) where you will be empowered, make an impact, learn a ton, grow rapidly, and genuinely enjoy yourself and your teammatesMeaningful equityRemote-friendlyOpen time-off policyThis is a rare opportunity to make a big impact, join a hyper growth company, and be part of an incredible team and culture. Cloverly is a collaborative, transparent, no-politics, no-ego, well funded team of startup veterans who have built unicorns such as Pendo and FullStory.We are committed to creating inclusive teams that foster a genuine workplace culture and a sense of belonging for each and every employee. We encourage everyone to apply.Cloverly provides equal employment opportunities (EEO) to all employees and applicants for employment without regard to race, color, religion, sex, national origin, disability, genetics, gender, sexual orientation, age, marital status, veteran status. In addition to federal law requirements, Cloverly complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities. This policy applies to all terms and conditions of employment, including recruiting, hiring, placement, promotion, termination, layoff, recall, transfer, leaves of absence, compensation, and training.**Must carry valid work authorization in the US or Canada, we cannot provide visa sponsorship at this timeShow more Seniority levelMid-Senior levelEmployment typeFull-timeJob functionMarketingIndustriesIT Services and IT Consulting and Environmental Services Referrals increase your chances of interviewing at Cloverly by 2xSee who you knowGet notified about new Digital Marketing Manager jobs in United States.Sign in to create job alertSimilar jobsSenior Implementation ConsultantSenior Implementation ConsultantTabSquareHong Kong, Hong Kong SAR15 minutes agoLicensed Insurance Agent – Avg $120k First YearLicensed Insurance Agent – Avg $120k First YearInsurTech AdvisorsUnited StatesJust nowFinance ManagerFinance ManagerApeiron BioenergyPathum Thani, Thailand10 minutes agoCRNA Casual Part Time – Alfred I duPont HospitalCRNA Casual Part Time – Alfred I duPont HospitalNemoursWilmington, DE1 minute agoVape Sales Representative in Europe and the USVape Sales Representative in Europe and the USHiredChina.com 为中国企业链接国际人才Hauts-de-France, France7 minutes agoPayroll Systems AdministratorPayroll Systems AdministratorFrontier CommunicationsRochester, NY5 minutes agoShow more jobs like this People also viewedTransportation Department SupervisorTransportation Department SupervisorRightPro StaffingSt Albans, VT5 minutes agoFranchise OwnerFranchise OwnerChick-fil-A Corporate Support CenterSalt Lake City, UT13 minutes agoCommunity Loan OfficerCommunity Loan OfficerRegions BankAtlanta, GA3 minutes agoSenior Comptable – PSF Grandissante, Service Sur-MesureSenior Comptable – PSF Grandissante, Service Sur-MesureAbiomis LuxembourgLuxembourg, Luxembourg, Luxembourg3 minutes agoTCS Hiring for Active directory_KolkataTCS Hiring for Active directory_KolkataTata Consultancy ServicesKolkata, West Bengal, India4 minutes agoLaboratory TechnicianLaboratory TechnicianFulton HoganMackay, Queensland, Australia11 minutes ago(Senior) Account Manager, eLearning Sales(Senior) Account Manager, eLearning SalesHKT HomeHong Kong, Hong Kong SAR2 minutes agoCustomer Support SpecialistCustomer Support SpecialistCrown Equipment Pty Ltd – AustraliaBrisbane, Queensland, AustraliaJust nowSenior Mining Engineer – JundeeSenior Mining Engineer – JundeeNorthern Star Resources LimitedPerth, Western Australia, Australia2 minutes agoSenior AccountantSenior AccountantSaltSydney, New South Wales, Australia3 minutes agoLooking for a job?Visit the Career Advice Hub to see tips on interviewing and resume writing.View Career Advice HubLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyYour California Privacy ChoicesCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/jobs/view/automation-digital-marketing-manager-at-cloverly-3512669528?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Huntress | Apply NowDirector of Sales Engineeringat Huntress (View all jobs)Remote USReports to: Chief Revenue OfficerLocation: RemoteCompensation: $245,000 – $265,000 on target earnings plus equityWhat We Do: Founded in 2015 by former NSA cyber operators, Huntress was built on a simple premise: to force hackers to earn every inch of their access.Today’s cyber-attacks aren’t limited to large organizations with the security tools that can ward off threats. Hackers don’t discriminate and will find a way to penetrate any vulnerability in any size business. Huntress enables IT providers and resellers to stop hidden threats that sneak past preventive security tools.Through a combination of expert human threat hunters, a comprehensive platform, and a desire to make the world a safer place, we’re working to deliver cybersecurity to the 99%—those small to midsize businesses that make up the backbone of our economy. Join the hunt and help us stop hackers in their tracks!What You’ll Do: Huntress is looking for an experienced Director of Sales Engineering to lead and continue growing our sales engineering team. You’ll lead our existing team of engineers, providing coaching and professional development while also reviewing procedures and policies, helping optimize the teams success. Our engineers partner with our sales teams and customers throughout the sales and renewal processes offering technical assistance and expertise, while also contributing to more successful outcomes. Playing such a key role in the sales process and interactions our customers have with us, this team will need a passionate and inspiring leader to assist in continuous improvement and efficiency as the company continues to grow and scale. We’re looking for an individual that has a demonstrated history of success leading teams, as well as a technically focused background in cyber security.Responsibilities:Lead, grow and mentor the global Technical Sales team; provide support as needed across all levels of the teamProvide actionable feedback to the team regarding areas of improvement throughout the sales process and/or customer’s technical needsArticulate the evolving security challenges to a diverse audience Partner with customers to help increase their technical security understandingLiaise with Sales, Marketing, Support, and Engineering on voicing customers’ technical needs as it relates to Huntress’ current and future solutionsEvaluate and propose improvements to the technical sales processAble to spot opportunities for improvement in the sales process that may be in need of improvement Comfortable traveling up to 50% of the time and meeting face to face with customersComfortable giving technical presentations regarding our product to large groups (from 5 – 500 people)What You Bring To The Team:10+ years of experience working as a Sales Engineer or in a similar role5+ years of experience in a Sales Engineering/Technical Sales leadership role, previous experience as a Director a plusExperience building teams, coaching and mentoringExperience in endpoint or network security space – eg. AV, EDR, incident response, forensics, SIEM, firewall, HIPS/IDS, etcExperience working in or with MSPs and VARsExperience with malware, threat intelligence, and/or sandbox analysisExcellent communication and presentation skills with the ability to present to a variety of external audiences, including C-level executivesEffective time management and organizational skillsExperience with programming or scripting languages such as PowerShell, Python, and Bash a plusExperience with cloud platforms such as AWS, Azure, GCP, etc.Familiarity with MSP tools such as RMMs and PSAsWhat We Offer: 100% remote work environment – since our founding in 2015Generous paid time off policy including vacation, sick time, and paid holidays12 weeks paid parental leaveHighly competitive and comprehensive medical, dental, and vision benefits plans 401(k) with 5% contribution regardless of employee contributionLife and Disability insurance plansStock options for all full-time employees One-time $500 stipend to build/upgrade home officeAnnual allowance for education and professional development assistance $75 USD/month digital reimbursementAccess to both Udemy and BetterUp platforms for coaching, personal, and professional growthHuntress is committed to creating a culture of inclusivity where every single member of our team is valued, has a voice, and is empowered to show up to work every day as their full self. We do not discriminate based on race, ethnicity, color, ancestry, national origin, religion, sex, sexual orientation, gender identity, disability, veteran status, genetic information, marital status or any other legally protected status. We do discriminate against hackers who try to exploit small businesses.Accommodations:If you require reasonable accommodation in completing this application, interviewing, completing any pre-employment testing, or otherwise participating in the employee selection process, please direct your inquiries to [email protected]. Please note non-accommodation requests to this inbox will not receive a response. If you have any questions about your personal data privacy at Huntress, please visit our privacy page.#BI-Remote Apply for this Job* RequiredFirst Name *Last Name *Email *Phone *Location (City) * Locate me Resume/CV *Attach Dropbox Google Drive or enter manually(File types: pdf, doc, docx, txt, rtf)Cover LetterAttach Dropbox Google Drive or enter manually(File types: pdf, doc, docx, txt, rtf)Will you now or in the future require sponsorship for employment visa status? (e.g. H-1B, E-3, TN status) *–Are you authorized to work for any employer in the United States? *–If applicable, please share a link to your professional website, portfolio, Github account or similar site herePlease provide LinkedIn profileWere you referred to Huntress by one of our employees? If so, whom?How did you hear about Huntress? Company page, job posting, event, somewhere else?Voluntary Self-IdentificationFor government reporting purposes, we ask candidates to respond to the below self-identification survey. Completion of the form is entirely voluntary. Whatever your decision, it will not be considered in the hiring process or thereafter. Any information that you do provide will be recorded and maintained in a confidential file.As set forth in Huntress’s Equal Employment Opportunity policy, we do not discriminate on the basis of any protected group status under any applicable law.GenderPlease selectGenderAre you Hispanic/Latino?Please selectAre you Hispanic/Latino?Race & Ethnicity DefinitionsIf you believe you belong to any of the categories of protected veterans listed below, please indicate by making the appropriate selection. As a government contractor subject to the Vietnam Era Veterans Readjustment Assistance Act (VEVRAA), we request this information in order to measure the effectiveness of the outreach and positive recruitment efforts we undertake pursuant to VEVRAA. Classification of protected categories is as follows:A “disabled veteran” is one of the following: a veteran of the U.S. military, ground, naval or air service who is entitled to compensation (or who but for the receipt of military retired pay would be entitled to compensation) under laws administered by the Secretary of Veterans Affairs; or a person who was discharged or released from active duty because of a service-connected disability.A “recently separated veteran” means any veteran during the three-year period beginning on the date of such veteran’s discharge or release from active duty in the U.S. military, ground, naval, or air service.An “active duty wartime or campaign badge veteran” means a veteran who served on active duty in the U.S. military, ground, naval or air service during a war, or in a campaign or expedition for which a campaign badge has been authorized under the laws administered by the Department of Defense.An “Armed forces service medal veteran” means a veteran who, while serving on active duty in the U.S. military, ground, naval or air service, participated in a United States military operation for which an Armed Forces service medal was awarded pursuant to Executive Order 12985.Veteran StatusPlease selectVeteran StatusForm CC-305OMB Control Number 1250-0005Expires 05/31/2023Voluntary Self-Identification of DisabilityWhy are you being asked to complete this form?We are a federal contractor or subcontractor required by law to provide equal employment opportunity to qualified people with disabilities. We are also required to measure our progress toward having at least 7% of our workforce be individuals with disabilities. To do this, we must ask applicants and employees if they have a disability or have ever had a disability. Because a person may become disabled at any time, we ask all of our employees to update their information at least every five years.Identifying yourself as an individual with a disability is voluntary, and we hope that you will choose to do so. Your answer will be maintained confidentially and not be seen by selecting officials or anyone else involved in making personnel decisions. Completing the form will not negatively impact you in any way, regardless of whether you have self-identified in the past. For more information about this form or the equal employment obligations of federal contractors under Section 503 of the Rehabilitation Act, visit the U.S. Department of Labor’s Office of Federal Contract Compliance Programs (OFCCP) website at www.dol.gov/ofccp.How do you know if you have a disability?You are considered to have a disability if you have a physical or mental impairment or medical condition that substantially limits a major life activity, or if you have a history or record of such an impairment or medical condition.Disabilities include, but are not limited to:AutismAutoimmune disorder, for example, lupus, fibromyalgia, rheumatoid arthritis, or HIV/AIDSBlind or low visionCancerCardiovascular or heart diseaseCeliac diseaseCerebral palsyDeaf or hard of hearingDepression or anxietyDiabetesEpilepsyGastrointestinal disorders, for example, Crohn’s Disease, or irritable bowel syndromeIntellectual disabilityMissing limbs or partially missing limbsNervous system condition for example, migraine headaches, Parkinson’s disease, or Multiple sclerosis (MS)Psychiatric condition, for example, bipolar disorder, schizophrenia, PTSD, or major depressionDisability StatusPlease selectDisability StatusPUBLIC BURDEN STATEMENT: According to the Paperwork Reduction Act of 1995 no persons are required to respond to a collection of information unless such collection displays a valid OMB control number. This survey should take about 5 minutes to complete.Powered by Read our Privacy Policy | https://boards.greenhouse.io/huntress/jobs/5532370003?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Huntress | Apply NowSoftware Engineering Manager, macOS Agentat Huntress (View all jobs)Remote US and CanadaReports to: Senior Director of EngineeringLocation: Remote, US and Canada OnlyCompensation Range: $140,000 to $190,000 plus bonus and equityWhat We Do: Founded in 2015 by former NSA cyber operators, Huntress was built on a simple premise: to force hackers to earn every inch of their access.Today’s cyber-attacks aren’t limited to large organizations with the security tools that can ward off threats. Hackers don’t discriminate and will find a way to penetrate any vulnerability in any size business. Huntress enables IT providers and resellers to stop hidden threats that sneak past preventive security tools.Through a combination of expert human threat hunters, a comprehensive platform, and a desire to make the world a safer place, we’re working to deliver cybersecurity to the 99%—those small to midsize businesses that make up the backbone of our economy. Join the hunt and help us stop hackers in their tracks!What You’ll Do:You’ll lead an engineering team that builds and supports our macOS Agent. You’ll work closely with the team’s product manager, designer, and cybersecurity expert to design, build, validate, and support both agent and web-based applications. You’ll grow and develop a team of smart and diverse problem solvers who are innovative, skilled, and passionate about delivering for our customers. As part of the engineering leadership team, you’ll help develop better ways for us to work. At Huntress, we work with low walls between disciplines because we believe good ideas are everywhere and the best products come from teams who work together to deeply understand our customers, experiment, and validate our products. Who You Are:You’ve been a software engineer and understand modern cloud-based architectures. You don’t need to code anymore to have fun at work, but you’re able to think both tactically and strategically about a solution and the right way to build it. You enjoy thinking about products as well as engineering and have a track record developing and iterating on SaaS products. You have managed technical teams and know how to coach and develop both individuals and a team.Responsibilities:Deliver awesome products for our customers that are maintainable, reliable, and resilient Recruit, hire, coach, and mentor a diverse team of engineers who are technically skilled, collaborative, and creativeIdentify and remove impediments for your teamContinuously improve your team’s performance and healthLead with transparency, candidly challenge assumptions, exhibit integrity above all else What You Bring To The Team3+ years experience in engineering leadership building SaaS products in a modern SaaS environmentSkilled at hiring, building teams, leading and coaching managers, and performance managementExperience with different software development methodologies such as plan-build-ship, scrum, and kanbanExcellent technical, diagnostic, and troubleshooting skillsAbility to grasp new software architecture and technology quicklyAbility to build strong interpersonal relationships with product, development teams, leadership, senior management, and internal and external stakeholders to help minimize silos and drive teamwork across teamsExperience with macOS internals and development is not required, but extremely beneficialWhat We Offer: 100% remote work environment – since our founding in 2015Generous paid time off policy including vacation, sick time, and paid holidays12 weeks paid parental leaveHighly competitive and comprehensive medical, dental, and vision benefits plans 401(k) with 5% contribution regardless of employee contributionLife and Disability insurance plansStock options for all full-time employees One-time $500 stipend to build/upgrade home officeAnnual allowance for education and professional development assistance $75 USD/month digital reimbursementAccess to both Udemy and BetterUp platforms for coaching, personal, and professional growthHuntress is committed to creating a culture of inclusivity where every single member of our team is valued, has a voice, and is empowered to show up to work every day as their full self. We do not discriminate based on race, ethnicity, color, ancestry, national origin, religion, sex, sexual orientation, gender identity, disability, veteran status, genetic information, marital status or any other legally protected status. We do discriminate against hackers who try to exploit small businesses.Accommodations:If you require reasonable accommodation in completing this application, interviewing, completing any pre-employment testing, or otherwise participating in the employee selection process, please direct your inquiries to [email protected]. Please note non-accommodation requests to this inbox will not receive a response. If you have any questions about your personal data privacy at Huntress, please visit our privacy page.#BI-RemoteApply for this Job* RequiredFirst Name *Last Name *Email *Phone *Location (City) * Locate me Resume/CV *Attach Dropbox Google Drive or enter manually(File types: pdf, doc, docx, txt, rtf)Cover LetterAttach Dropbox Google Drive or enter manually(File types: pdf, doc, docx, txt, rtf)Will you now or in the future require sponsorship for employment visa status? (e.g. H-1B, E-3, TN status) *–Are you authorized to work for any employer in the United States? *–If applicable, please share a link to your professional website, portfolio, Github account or similar site herePlease provide LinkedIn profileWere you referred to Huntress by one of our employees? If so, whom?How did you hear about Huntress? Company page, job posting, event, somewhere else?Voluntary Self-IdentificationFor government reporting purposes, we ask candidates to respond to the below self-identification survey. Completion of the form is entirely voluntary. Whatever your decision, it will not be considered in the hiring process or thereafter. Any information that you do provide will be recorded and maintained in a confidential file.As set forth in Huntress’s Equal Employment Opportunity policy, we do not discriminate on the basis of any protected group status under any applicable law.GenderPlease selectGenderAre you Hispanic/Latino?Please selectAre you Hispanic/Latino?Race & Ethnicity DefinitionsIf you believe you belong to any of the categories of protected veterans listed below, please indicate by making the appropriate selection. As a government contractor subject to the Vietnam Era Veterans Readjustment Assistance Act (VEVRAA), we request this information in order to measure the effectiveness of the outreach and positive recruitment efforts we undertake pursuant to VEVRAA. Classification of protected categories is as follows:A “disabled veteran” is one of the following: a veteran of the U.S. military, ground, naval or air service who is entitled to compensation (or who but for the receipt of military retired pay would be entitled to compensation) under laws administered by the Secretary of Veterans Affairs; or a person who was discharged or released from active duty because of a service-connected disability.A “recently separated veteran” means any veteran during the three-year period beginning on the date of such veteran’s discharge or release from active duty in the U.S. military, ground, naval, or air service.An “active duty wartime or campaign badge veteran” means a veteran who served on active duty in the U.S. military, ground, naval or air service during a war, or in a campaign or expedition for which a campaign badge has been authorized under the laws administered by the Department of Defense.An “Armed forces service medal veteran” means a veteran who, while serving on active duty in the U.S. military, ground, naval or air service, participated in a United States military operation for which an Armed Forces service medal was awarded pursuant to Executive Order 12985.Veteran StatusPlease selectVeteran StatusForm CC-305OMB Control Number 1250-0005Expires 05/31/2023Voluntary Self-Identification of DisabilityWhy are you being asked to complete this form?We are a federal contractor or subcontractor required by law to provide equal employment opportunity to qualified people with disabilities. We are also required to measure our progress toward having at least 7% of our workforce be individuals with disabilities. To do this, we must ask applicants and employees if they have a disability or have ever had a disability. Because a person may become disabled at any time, we ask all of our employees to update their information at least every five years.Identifying yourself as an individual with a disability is voluntary, and we hope that you will choose to do so. Your answer will be maintained confidentially and not be seen by selecting officials or anyone else involved in making personnel decisions. Completing the form will not negatively impact you in any way, regardless of whether you have self-identified in the past. For more information about this form or the equal employment obligations of federal contractors under Section 503 of the Rehabilitation Act, visit the U.S. Department of Labor’s Office of Federal Contract Compliance Programs (OFCCP) website at www.dol.gov/ofccp.How do you know if you have a disability?You are considered to have a disability if you have a physical or mental impairment or medical condition that substantially limits a major life activity, or if you have a history or record of such an impairment or medical condition.Disabilities include, but are not limited to:AutismAutoimmune disorder, for example, lupus, fibromyalgia, rheumatoid arthritis, or HIV/AIDSBlind or low visionCancerCardiovascular or heart diseaseCeliac diseaseCerebral palsyDeaf or hard of hearingDepression or anxietyDiabetesEpilepsyGastrointestinal disorders, for example, Crohn’s Disease, or irritable bowel syndromeIntellectual disabilityMissing limbs or partially missing limbsNervous system condition for example, migraine headaches, Parkinson’s disease, or Multiple sclerosis (MS)Psychiatric condition, for example, bipolar disorder, schizophrenia, PTSD, or major depressionDisability StatusPlease selectDisability StatusPUBLIC BURDEN STATEMENT: According to the Paperwork Reduction Act of 1995 no persons are required to respond to a collection of information unless such collection displays a valid OMB control number. This survey should take about 5 minutes to complete.Powered by Read our Privacy Policy | https://boards.greenhouse.io/huntress/jobs/5540671003?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Optera | | https://opteraclimate.com/wp-content/uploads/2023/03/Staff-Product-Manager.pdf?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Optera | | https://opteraclimate.com/wp-content/uploads/2023/03/VP-of-Finance-Job-Description.pdf?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Dyania Health | Skip to main contentLinkedInJobsDismissDismissJoin nowSign inNLP Applied Science InternshipDyania Health Jersey City, NJ1 month ago Be among the first 25 applicants See who Dyania Health has hired for this roleApplySaveAt Dyania Health, interns get the chance to invent and apply cutting-edge NLP technology with the aim of transforming the way clinical trials are conducted. You will use large pretrained language models to analyze clinical text data and extract useful information from it. There is a tremendous range of interesting research questions in that space, and you will be expected to write a paper summarizing your results and publish it in a top-tier NLP conference. You will work alongside team members with deep technical expertise in NLP and machine learning, as well as top medical professionals (MDs, pharmacology PhDs, and others). The ideal candidate will have strong foundations in computer science and ML/NLP, exceptional analytical ability, tolerance for ambiguity, good communication skills, and most importantly, a strong desire to learn and grow.RequirementsRequired Qualifications:Enrolled in a graduate program (preferably a PhD program) in a field such as Computer Science, Mathematics, Electrical Engineering, or BioinformaticsPractical experience with training and evaluating transformer models using Python-based ML frameworks and libraries such as PyTorch and HuggingFaceFluency in PythonPreferred Qualifications:Background in BioinformaticsPractical experience parallelizing training and inference for large models using libraries such as DeepSpeedPublications in top-tier NLP conferencesResponsibilities:Invent, build, evaluate, and deploy algorithms and models to accurately extract medical information from structured and unstructured data sourcesAnalyze performance results and convey your analyses to relevant stakeholdersConduct research and publish your findings at relevant scientific venuesTeam Culture:We lead with empathy for patients and our teammates.We value small egos, self-awareness, and humility in our teammates.We appreciate flexible and adaptive attitudes towards solving problems, as strategic priorities may shift.We love diversity of thought, perspective, working style, skill set, knowledge, and interests amongst our team.We value open dialogue and brainstorming across multidisciplinary teams.Dyania Health is an equal opportunity employer that is committed to workplace diversity and inclusion. We do not discriminate on the basis of race, gender, gender identity, color, religion, national origin, sexual orientation, or any other legally protected characteristic as outlined by federal, state, or local laws.Show more Seniority levelNot ApplicableEmployment typeFull-timeJob functionEngineeringIndustriesTechnology, Information and Internet Referrals increase your chances of interviewing at Dyania Health by 2xSee who you knowGet notified about new Science Specialist jobs in Jersey City, NJ.Sign in to create job alertSimilar jobsMedical DirectorMedical DirectorNeuroglee TherapeuticsBoston, MA7 minutes agoFinance ManagerFinance ManagerApeiron BioenergyPathum Thani, Thailand10 minutes agoCRNA Casual Part Time – Alfred I duPont HospitalCRNA Casual Part Time – Alfred I duPont HospitalNemoursWilmington, DE1 minute agoVape Sales Representative in Europe and the USVape Sales Representative in Europe and the USHiredChina.com 为中国企业链接国际人才Hauts-de-France, France7 minutes agoFinance ManagerFinance ManagerAnjun BrasilSão Paulo, São Paulo, Brazil13 minutes agoProduktansvarig Säljare till GranzowProduktansvarig Säljare till GranzowPoolia SverigeEnköping, Uppsala County, Sweden7 minutes agoShow more jobs like this People also viewedTransportation Department SupervisorTransportation Department SupervisorRightPro StaffingSt Albans, VT5 minutes agoFranchise OwnerFranchise OwnerChick-fil-A Corporate Support CenterSalt Lake City, UT13 minutes agoCommunity Loan OfficerCommunity Loan OfficerRegions BankAtlanta, GA3 minutes agoSenior Comptable – PSF Grandissante, Service Sur-MesureSenior Comptable – PSF Grandissante, Service Sur-MesureAbiomis LuxembourgLuxembourg, Luxembourg, Luxembourg3 minutes agoLaboratory TechnicianLaboratory TechnicianFulton HoganMackay, Queensland, Australia11 minutes ago(Senior) Account Manager, eLearning Sales(Senior) Account Manager, eLearning SalesHKT HomeHong Kong, Hong Kong SAR2 minutes agoHuman Resources OfficerHuman Resources OfficerAusGroup – AGC | MASPerth, Western Australia, Australia12 minutes agoCustomer Support SpecialistCustomer Support SpecialistCrown Equipment Pty Ltd – AustraliaBrisbane, Queensland, AustraliaJust nowSenior Mining Engineer – JundeeSenior Mining Engineer – JundeeNorthern Star Resources LimitedPerth, Western Australia, Australia2 minutes agoSenior AccountantSenior AccountantSaltSydney, New South Wales, Australia3 minutes agoLooking for a job?Visit the Career Advice Hub to see tips on interviewing and resume writing.View Career Advice HubLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyYour California Privacy ChoicesCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/jobs/view/nlp-applied-science-internship-at-dyania-health-3525013421?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| ANRA Technologies | HOME COMPANY TECHNOLOGY SOLUTIONS NEWSSearch for: HOME | STRATEGY AND BUSINESS DEVELOPMENT MANAGER WITH DRONE/AEROSPACE EXPERIENCEPosted on March 14, 2023 by Leida MejiaFull TimeNew DelhiPosted 5 days agoWebsiteANRA TechnologiesWe are seeking a highly motivated Business Development Manager with proven experience in leading business strategy and growth initiatives in markets that focus on technology development, primarily in the Indian market. Experience in Drone/Aerospace is preferred.CompanyANRA Technologies, with offices in Washington DC, London, New Delhi and Estonia, is an international leading provider of drone operations and traffic management solutions for unmanned aircraft systems (UAS) operators and airspace managers. We offer intelligent Machine Learning and AI driven traffic management software capabilities for UAS Traffic Management (UTM) and Urban Air Mobility (UAM) operations.Responsibilities and DutiesProvide thought leadership and strategic guidance.Analyze current and new markets, develop campaign / capture strategies to grow our business.Gather pertinent information on market and the competition.Identify funding sources and sales vehicles.Identify initial customers and requirements including identify influencers and key decision makers, determine initial ‘price-to-win’ and shape towards ANRA products.Communicate regularly with management. Works closely with Product Managers to provide customer requirements and competitive feedback.Support development of corporate and/or organizational policies. Responsible for the implementation within their team.Oversee the execution of proposal process to include writing or assigning required resources to develop proposal content and conformance to RFP requirements.Ensure regulatory and requirement compliance of all offerings; Focuses on new business models that leverage enabling trends.Solve customer problems in larger potential markets and rapidly assemble internal and external capabilities required to achieve growth in an extremely competitive marketplace.Occasionally, represent the company in various public forums to include national conferences, media interviews and industry associations.Other duties as assigned.Basic QualificationsBachelor’s Degree in a related field of study is required or equivalent combination of education, training, and experience.5 years of demonstrated experience in leadership with a strong background in general management of business development activities.Business or technical degree with business development experience of at least 3 years.Demonstrated experience in developing competitive proposals, including R&D.Ability to travel.Other Qualifications & Desired CompetenciesDemonstrates excellent written and verbal communication skills.Strong understanding of government proposal and program requirements.Strong understanding of regulatory requirements for Indian government programs, as well as domestic sales.Able to perform in a rapidly growing organization with rapidly changing requirements and sales targets.Uses vision to think beyond the immediate situation, explore multiple potential paths, and adapt decision-making style based on the situational circumstances.Brings organizational values to life using personality, uniqueness, and the creation of a shared vision.Champions the process of change and promotes a culture of quick adaptation while helping others deal with the effects of change.Posted inSR. IOS MOBILE DEVELOPERSR. MOBILE DEVELOPERANRA TECHNOLOGIES © 2023. Privacy Policy▼Keep up with our Latest News We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy | https://www.anratechnologies.com/home/job/strategy-and-business-development-manager-with-drone-aerospace-experience-2/?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| backstitch | Skip to formFirst nameLast nameEmailPhone numberState/RegionJob Applying ForResume and Cover Letter You can upload multiple filesPortfolio or WebsiteMessage backstitchbackstitch is committed to protecting and respecting your privacy, and we’ll only use your personal information to administer your account and to provide the products and services you requested from us. From time to time, we would like to contact you about our products and services, as well as other content that may be of interest to you. If you consent to us contacting you for this purpose, please tick below to say how you would like us to contact you:I agree to receive other communications from backstitch.You can unsubscribe from these communications at any time. For more information on how to unsubscribe, our privacy practices, and how we are committed to protecting and respecting your privacy, please review our Privacy Policy.By clicking submit below, you consent to allow backstitch to store and process the personal information submitted above to provide you the content requested.Submit | https://www.backstitch.io/cs/c/?cta_guid=291f15ba-2a26-4ca6-8c3d-fd2246b80bc8&signature=AAH58kFCVRJ42MTBokt9s0j-Rcioo7wXag&pageId=5610906026&placement_guid=db5fd7ab-2327-4f74-89d5-f0df5800c44b&click=fda3f4c2-e6f5-4bb4-ab0e-37b6fb1872c1&hsutk=474b1cb160ae017cd633ea5fbbc202f0&canon=https%3A%2F%2Fwww.backstitch.io%2Fcareers&portal_id=731034&redirect_url=APefjpHmoh3U-AQaxQXSvfY0eGMlj4hV4xZOUq-G1f11vNaig1NoAOl8O70gU12vVl9rdme4mv_CBpw0g2vJmtqdNv7pOHhiKc4f_61vajOqO65QoWvJ6vq56ysfN6iSuE2dLLzExu89kbT-Pt6HDdSlcGHKYnm6nQ&__hstc=139043244.474b1cb160ae017cd633ea5fbbc202f0.1679224346319.1679224346319.1679224346319.1&__hssc=139043244.1.1679224346319&__hsfp=810004322&contentType=standard-page&utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Palmetto | Skip to main contentLinkedInJoin LinkedInEmailPassword (8+ characters)By clicking Agree & Join, you agree to the LinkedIn User Agreement, Privacy Policy, and Cookie Policy.Agree & JoinAlready on Linkedin? Sign inLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/jobs/view/sales-representative-experience-sx-program-manager-at-palmetto-3522212237?utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | Skip to main contentLinkedInJoin LinkedInEmailPassword (8+ characters)By clicking Agree & Join, you agree to the LinkedIn User Agreement, Privacy Policy, and Cookie Policy.Agree & JoinAlready on Linkedin? Sign inLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/jobs/view/sales-experience-sx-director-at-palmetto-3522209220?utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | Skip to main contentLinkedInJoin LinkedInEmailPassword (8+ characters)By clicking Agree & Join, you agree to the LinkedIn User Agreement, Privacy Policy, and Cookie Policy.Agree & JoinAlready on Linkedin? Sign inLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/jobs/view/project-engineer-ii-at-palmetto-3520088604?utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| University of Chicago, Development Innovation Lab | | https://uchicago.wd5.myworkdayjobs.com/External/job/Illinois-Chicago/Policy-Analyst_JR21066 |
| Palmetto | Skip to main contentLinkedInJoin LinkedInEmailPassword (8+ characters)By clicking Agree & Join, you agree to the LinkedIn User Agreement, Privacy Policy, and Cookie Policy.Agree & JoinAlready on Linkedin? Sign inLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/jobs/view/senior-project-engineering-manager-at-palmetto-3520090370?utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | Skip to main contentLinkedInJoin LinkedInEmailPassword (8+ characters)By clicking Agree & Join, you agree to the LinkedIn User Agreement, Privacy Policy, and Cookie Policy.Agree & JoinAlready on Linkedin? Sign in | https://www.linkedin.com/jobs/view/principal-product-designer-at-palmetto-3522656903?utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| SPAN | Apply NowData Analystat SPAN(View all jobs)San FranciscoOur MissionAt Span, we are building products to drive the rapid adoption of renewable energy by designing the infrastructure for a distributed, renewable grid. Our smart panel reinvents home electrical systems as part of the distributed grid and makes user-friendly renewable energy at the center of the smart home, presenting intelligent load-balancing and revolutionary edge-of-grid controls to homeowners through the Span mobile app.The TeamThe Research and Development Org is the driving force behind SPAN’s technology. The team designs and completes a wide range of test setups and experiments, crafting a pathway that will best meet the needs at hand and moving collectively and independently across department constraints. The Eccles Lab facility is solely focused on implementing the vision and practical application of existing and new product testing and development.The RoleWe aim to establish the SPAN panel as the center of home energy and the backbone of the renewable distributed grid. As Data Analyst leader on our team, you will define the strategy for information flows and insights around the company. You will support company leaders by providing access to strategic information, and being a thought-partner in defining and tracking KPI’s. You will also support our hardware and software product teams by structuring our dashboards to help them identify issues and opportunities.The job responsibilities include:Designing, implementing and monitoring metricsEnsuring engagement and adoption of dashboards and fostering a culture of data-driven decisionsLeading the design and execution of the communication of information to stakeholders on all levelsBuilding scalable solutions to help software and hardware teams to identify and investigate issuesAutomating information flows by using data pipelines, dashboards, and reportsBeing a thought leader and implementation partner to the product development teamsNote: We’re a startup, so while this list is broad, it’s still just a start; you’ll end up wearing many hats during your time at Span.About You Required QualificationsBachelor’s degree or higher in Computer Science, Mathematics, Engineering, or a closely related field.5+ years’ professional experience doing data analysis and dashboards on large data setsAdvanced proficiency with SQL, Python, and GitExtensive experience with Tableau, and/or experience with other data visualization platforms such as Cluvio or LookerAbility to work independently on complex projectsPassion and willingness to mentor and support career development for juniorsGood verbal and written communication skills, particularly withsenior business leadersBonus QualificationsProfessional experience in energy and/or hardware product developmentExperience with time series dataExperience with writing data pipelines (e.g., Airflow, Prefect, etc.) The U.S. base salary range for this position is $125,600 – $148,700 plus benefits, equity and variable compensation for Sales-related roles. This range represents SPAN’s good faith estimate of competitively-priced salary for the role based on national, real-time industry data from companies of a similar growth stage. This range reflects minimum and maximum new hire salaries for the role across US locations. Within the range, individual pay is determined by location and individual factors including relevant skills, experience and education or training. This range correlates to the relative level of the candidate we believe we need for the role and may require an adjustment for candidates of a different level. Your recruiter can share more about the specific salary range for the location this role is based during the hiring process. Life at SPANHeadquartered in San Francisco’s vibrant SoMa neighborhood, we are an eclectic group of creative thinkers who value open communication, teamwork, and a ‘make it happen’ approach to addressing complex challenges. SPAN embraces diversity and equal opportunity in a serious way. We are committed to building a team that represents a variety of backgrounds, perspectives, and skills. We’re hiring talented individuals who are driven by success and are passionate about shaping the future of renewable energy. If that sounds like you, we’d love for you to consider joining the rapidly growing team at SPAN.The Perks:⚡ Competitive compensation + equity grants at a well-funded, venture-backed company⚡ Comprehensive benefits (including medical; dental, vision, life and disability insurance)⚡ Comfortable, sunny office space located near BART and Caltrain public transit⚡ Strong focus on team building and company culture (events, meet-ups, clubs)⚡ Flexible hours and unlimited PTOApply for this Job* RequiredFirst Name *Last Name *Email *PhoneResume/CVAttach Dropbox Google Drive or enter manually(File types: pdf, doc, docx, txt, rtf)Cover LetterAttach Dropbox Google Drive or enter manually(File types: pdf, doc, docx, txt, rtf)LinkedIn ProfileWebsite | https://boards.greenhouse.io/spanio/jobs/5547342003?utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | PalmettoSign in with LinkedInPermitting Team LeadPalmetto United States (Remote)Posted 3 days agoFull-timeEngineeringIT Services and IT ConsultingRenewable Energy Semiconductor ManufacturingApplyMeet the hiring teamCourtney Tutt KochelTalent Acquisition CoordinatorJob PosterAbout the jobCompany DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleThe Permitting Team Lead (Manager when applicable) will be responsible for permit management across pre-determined regions, managing KPIs for throughput and service levels. This includes management of internal resources and 3rd party vendors to achieve targeted service levels and volume throughput to support Palmetto’s revenue targets.Strategic & TacticalManage regional permit throughput to pre-defined success targetsCoordinate with internal teams and the Senior Permit Manager to reduce and quickly resolve requirements that may block or slow down permit turnaround timeWork with CX leadership to ensure any required customer or sales member communication is flawlessAssist with the recruiting, negotiation, and implementation of Palmetto’s Permit vendor network in order to provide burst capacity, expanded geographical coverage, and lower per-unit economics as Palmetto throughput scalesCoordinate closely with the Design and Engineering and Field Operations/SQT groups to drive down permit and inspection rejections and failuresOwn oversight for maintaining a current and accurate AHJ database for permit and inspection requirements, submittal methods, and scheduling requirements for your respective regionSupport daily throughput as required by owning digital permit throughput on an as-needed basisOversee expansion plans into new markets with regard to permitting requirementsManage oversight of notice of commencement pipeline in the state of FloridaManage oversight of local coordinators, including throughput and pipeline management, performance management, and career developmentSupport and train permit coordinators as well as third-party providers in permitting processesQualifications3-5 years of operational leadership experience with a demonstrated track record of process improvement and leadership capabilitySolar field experience with a focus on permit and inspection operational deliverablesTrack record managing regional permit and inspection throughput at a high volumeDemonstrated leadership capabilities in a fast-paced, change-oriented environmentExcellent organizational skills and ability to prioritizeExcellent analytical skillsBA/BS in a related discipline or equivalent combination of education and experienceEmployment is contingent upon the successful completion of a background checkEqual Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.Process ImprovementNegotiationOperations ManagementAnalytical SkillsRecords ManagementProject ManagementTeam LeadershipInspectionCustomer ManagementEnergy StorageLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3524251439?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=9wDp%2FtMHBh327w2b2HPK6Q%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | PalmettoSign in with LinkedInSenior AccountantPalmetto United States (Remote)Posted 3 weeks agoFull-timeAccounting/AuditingFinanceIT Services and IT ConsultingRenewable Energy Semiconductor ManufacturingApplyMeet the hiring teamCourtney Tutt KochelTalent Acquisition CoordinatorJob PosterAbout the jobCompany DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleThis role will be critical to the success of our accounting function. 100% remote position will be responsible for assisting with the monthly, quarterly, and annual close process as well as the preparation of the Company’s quarterly and annual consolidated financial statements. We are looking for someone with a strong accounting background, and a keen eye for detail, who is excited to make an impact, add value, and collaborate with a team in a fast-paced, ever-growing environment.Strategic & TacticalResponsible for assisting with the monthly, quarterly, and annual close process as well as the preparation of the Company’s quarterly and annual consolidated financial statementsAssist with the monthly, quarterly, and yearly close and full consolidation processPrepare quarterly and annual financial statements including the statement of cash flows and supporting footnotesAssist with reconciliations and other close items as necessaryDocument relevant technical accounting mattersSupport special projects such as acquisitionsServe as liaison between accounting and financeWork closely with subsidiary controllers and other key business partnersAssist external auditors in the review of quarterly and annual financial informationQualificationsBachelor’s degree with accounting major (or Master’s degree in Accounting)Minimum of two years experience in financial reporting or public accounting; CPA or CPA candidate is a plusStrong interpersonal, written, and verbal communication skills; strong attention to detailAn energetic, proactive individual capable of succeeding in a fast-paced environment; ability to work comfortably with senior managementStrong planning and organizational skillsBachelor’s or Master’s degree in AccountingMinimum of 2 years of relevant experienceCPA or CPA candidate preferredProficient Microsoft Office knowledge and skillsStrong time management and organizational skillsKnowledge of basic accounting principlesHigh degree of attention to detail and analytic abilitiesAbility to work independently and prioritize tasksOur tech stack includes NetSuite, Stampli, Concur, GSuite, and moreEmployment is contingent upon the successful completion of a background check.Equal Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.Close ProcessAccountingFinancial ReportingConcurConsolidated Financial StatementsYear-End Close ProcessAccount ReconciliationFinanceGoogle WorkplaceCustomer ManagementLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3505605968?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=4ZkS9+YiejNbYU0hW2OwXA%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | PalmettoSign in with LinkedInBusiness Development DirectorPalmetto United States (Remote)Posted 1 month agoFull-timeBusiness DevelopmentIT Services and IT ConsultingRenewable Energy Semiconductor ManufacturingApplyMeet the hiring teamCourtney Tutt KochelTalent Acquisition CoordinatorJob PosterAbout the jobPalmetto is constantly hiring! This posting is for future Business Development Director opportunities as they come available. By applying, you will be submitting your resume into our pool of candidates for future opportunities.Company DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleA Business Development Director will be regional and be responsible for generating sales and growth within their region. Focus areas will be around partner production, new accounts, partner churn, and sales member experience/support. Successfully focusing on those areas will ensure a highly productive region. Each region will work towards state-level and company sales goals.The successful candidate will be resourceful, a leader, proactive, organized, and motivated to increase sales, enhance the company’s reputation, and look for new and creative revenue opportunities.Strategic & TacticalConducting market research and knowing Total Addressable Market for each state in the regionDevelop strategic growth plans around regions specific TAMAbility to manage a regional budgetCultivating strong relationships with Partners with the assistance of in-state Business Development ManagersWork with marketing on lead generation and funnel flowWorking closely with staff across departments to implement growth strategiesDeveloping and implementing sales strategies, client service, and retention plansAnalyzing sales data to inform or update marketing strategiesAssist with drafting business plans, sales pitches, presentations, reference material, and other documents as requiredAbility to manage multiple projects concurrently and meet company sales goalsIdentify new business opportunities and partnersIdentify and escalate major blockers from preventing sales growthCollating and maintaining prospect information in the CRM databaseKnow all current sales opportunities Palmetto is offeringSales member NPS trackingAnticipate and manage potential roadblocksAttend conferences throughout the year to develop new business opportunitiesQualifications5+ years managing business development teamsWillingness to travel as neededStrong organization and time management skillsFriendly and personable demeanorProficient in Microsoft Office and relevant softwareEqual Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.Sales AnalysisBusiness DevelopmentCustomer Relationship Management (CRM)Budget ManagementSales PresentationsSales StrategyOrganization SkillsGrowth StrategiesAnalytical SkillsSalesLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3468524798?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=HZ3bSYr7KboNvkO+aiRHLQ%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | PalmettoSign in with LinkedInBusiness Development ManagerPalmetto United States (Remote)Posted 1 month agoFull-timeCustomer ServiceIT Services and IT ConsultingRenewable Energy Semiconductor ManufacturingApplyMeet the hiring teamCourtney Tutt KochelTalent Acquisition CoordinatorJob PosterAbout the jobPalmetto is constantly hiring! This posting is for future Business Development Manager opportunities as they come available. By applying, you will be submitting your resume into our pool of candidates for future opportunities.Company DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleA Business Development Manager will be charged with recruiting new partners, building relationships, and ensuring that these partners continue to sell on the platform once onboarded. The 3 KPIs are Production, Churn, and Sales Member NPS. Successfully hitting all 3 KPIs will ensure a highly productive region. A Business Development Manager will run a state or area within a state depending upon the size and total addressable market. A successful business development manager will be able to forge solid relationships at the rep level and provide in-field feedback that helps drive sales in their market.Strategic & TacticalWilling to familiarize themselves with the company’s vision and mission, seeking to accomplish set goals and objectivesConducting market research and knowing TAM for each state in the regionCultivating strong relationships with new partners, while maintaining existing client relationshipsAbility to provide informative feedback that removes obstacles and drives resultsWorking closely with staff across departments to implement growth strategiesAbility to manage multiple projects concurrently and meet deadlinesDemonstrate strong interpersonal skills with the ability to engage effectively with various levels of management, staff, and clienteleMaintain field journal to collate direct lines of communication of blockers and opportunities to management. Document key ideas and market points during the Trello ingestBuild dependable and repeatable lead-generation strategiesContribute the success of one’s teammates by collaborating, dropping in and cross-pollinating ideas and best practicesCollating and maintaining client information in the CRM databaseQualifications2+ years’ relevant work experience in business development or a similar field requiredWillingness to travel as neededExcellent written and verbal communication skillsAbility to handle multiple projects simultaneously and work under pressureStrong organization and time management skillsFriendly and personable demeanorProficient in Microsoft Office and relevant softwareEmployment is contingent upon the successful completion of a background check.Equal Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.Business DevelopmentCustomer Relationship Management (CRM)LeadershipProject ManagementCustomer ManagementOrganization SkillsRelationship BuildingEnergy StorageSolar PowerSalesLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3468518864?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=aLw2UPJ9D6zjkJ0WIAFUSA%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | PalmettoSign in with LinkedInSenior Expense AnalystPalmetto United States (Remote)Posted 1 month agoFull-timeAccounting/AuditingIT Services and IT ConsultingRenewable Energy Semiconductor ManufacturingApplyMeet the hiring teamHilary ThompsonSenior Talent Acquisition Manager at PalmettoJob PosterAbout the jobCompany DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleThis role will be critical to the success of our accounting function. You will be responsible for partnering with the business to manage overall spending and providing management with the detailed expense and other related ad-hoc reports. The Expense Analyst will take a lead role in daily expense approval, reimbursement processing, and compliance auditing. We are looking for someone with a keen eye for detail and process optimization, who is excited to make an impact, add value, and collaborate with a team in a fast-paced, ever-growing environment.Strategic & TacticalManage overall corporate purchase card and travel and entertainment expense programsResponsible for daily expense funding and exception requestsReview receipts and other required documentation to ensure spend is justified and within company guidelinesManage and update authority levels and approval hierarchyOnboard and offboard employeesWork with process owners to ensure expense documentation is clear and understandableEnsure expenses are processed to the correct department and coded correctlyMaintain ongoing support of related software and help implement new technologies and processes as neededAssist in developing internal reports and analyzing expense trendsAssist management with ad-hoc requests and special projectsAssist with related quarterly and annual audit requestsQualificationsDemonstrates a strong understanding of workflows, root cause analysis, accountability, compliance, confidentiality, and adherence to policiesExcellent customer service including strong interpersonal and communication skillsStrong planning and organizational skillsYour attention to detail is top notchMinimum of 2 years of relevant experienceProficient Microsoft Office knowledge and skillsStrong time management and organizational skillsKnowledge of basic accounting principlesHigh degree of attention to detail and analytic abilitiesAbility to work independently and prioritize tasksOur tech stack includes NetSuite, Stampli, Concur, GSuite, and moreEmployment is contingent upon the successful completion of a background check.Equal Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.Analytical SkillsAccountingExpense AnalysisExpense ReportsProject ManagementCustomer ServiceRoot CauseRenewable EnergyGoogle WorkplaceConcurLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3480609860?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=7DlMPUb7NqXtW2kRXrmM3g%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | PalmettoSign in with LinkedInGrowth MarketerPalmetto United States (Remote)Posted 2 weeks agoFull-timeMarketingSalesIT Services and IT ConsultingRenewable Energy Semiconductor ManufacturingApplyMeet the hiring teamCourtney Tutt KochelTalent Acquisition CoordinatorJob PosterAbout the jobCompany DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleThe Growth Marketer at Palmetto is a customer-centric, results-focused marketer who will lead our paid lead acquisition and digital advertising efforts. The ideal candidate will be responsible for managing all aspects of paid advertising campaigns, including display and social media ads, as well as managing lead vendors, based on the allocation of a monthly budget. The candidate will work closely with the marketing team to develop and execute growth strategies that drive new leads and sales.Strategic & TacticalReporting to the Sr Director, Growth Marketing, you will develop and execute paid advertising campaigns across multiple platforms, including display and social media ads, to acquire new leads and customers for Palmetto’s Direct to Consumer channelManage and optimize existing campaigns to improve performance and increase ROICollaborate with the marketing and design teams to create compelling ad creative and messaging that resonates with our target audienceContinuously test and iterate to improve performance and maximize resultsMonitor and report on key metrics, including cost per lead, CAC, conversion rates, and ROIEvaluate new lead vendors to maintain a database of lead acquisition opportunities and onboard new vendorsManage relationships with lead vendors and negotiate pricing to maximize the value of our investment, based on performance metricsStay up to date with industry trends and best practices to ensure our campaigns are innovative and effectiveQualificationsBachelor’s degree in marketing, advertising, or a related field3+ years of experience in digital marketing, with a focus on paid advertising and lead generationStrong analytical skills and experience working with data to drive business decisionsExperience managing advertising campaigns across multiple major ad platforms, including Google Ads and Facebook AdsExcellent written and verbal communication skills, with the ability to craft compelling ad messaging and collaborate with cross-functional teamsResults-oriented mindset with a track record of delivering on aggressive growth targetsAbility to manage multiple priorities and projects in a fast-paced, dynamic environmentEmployment is contingent upon the successful completion of a background check.Equal Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyUpdated 9/8/22: HTShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.Analytical SkillsAdvertisingCommunicationFacebook AdsCustomer Relationship Management (CRM)Cross-functional Team LeadershipLead GenerationDigital MarketingOral CommunicationMarketingFeatured benefitsEmployer-providedMedical insurance, dental insurance, vision insurance, paid maternity leave, paid paternity leave, student loan assistance, tuition assistance, and disability insuranceLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3511789920?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=OkRxw+Z7aaPI6PUEwzosfg%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | PalmettoSign in with LinkedInSales Experience (Sx) DirectorPalmetto Charlotte, NC (Hybrid)Posted 4 days agoFull-timeSalesIT Services and IT ConsultingRenewable Energy Semiconductor ManufacturingApplyMeet the hiring teamCourtney Tutt KochelTalent Acquisition CoordinatorJob PosterAbout the jobCompany DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleIn this role, you will lead the team of Sales Representative Experience Managers to grow and retain our Sales Representative network, with a primary focus on driving projects through to completion. This is the launch of fee-based services for Sales Representatives to provide thorough, white-glove concierge services.Strategic & TacticalBuild, develop, and scale the team in line with business needs. Responsible for all hiring, coaching, and proactive performance management to ensure a high-performing team meeting SLAs.Serve as the external point of contact for new relationships and potential partnerships. Ability to brand and market the SX team to external parties and showcase the value of our white glove concierge teamEffectively manage project escalations across the SX teamPartner with the Customer Lead Directors to ensure alignment across key processes (such as change orders, and cancellations)Work closely with the SX Program Manager for SOP creation, training programs, and continuous improvementPartner with Product and other Customer Experience teams to standardize tools and systems as well as set the business vision for the product roadmapOversee and approve billing and invoicing for the team’s workQualifications8-12 years experience leading teams in a sales, operations, or customer experience roleTrack record of building high-performing teams with a strong cultureAbility to empower team members to solve problemsExperience developing success metrics and tracking team performanceProven ability to partner across different groups to achieve a common goalAbility to work cross-functionally to remove roadblocksExperience in the solar industry is preferred but not requiredEmployment is contingent upon the successful completion of a background check.Equal Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.Solar IndustrySalesTeam LeadershipCustomer ExperienceSales ProcessesProblem SolvingProject ManagementProduct Road MappingSolar EnergyCustomer ManagementFeatured benefitsEmployer-providedMedical insurance, dental insurance, vision insurance, paid maternity leave, paid paternity leave, student loan assistance, tuition assistance, and disability insuranceLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3522209220?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=5YEDiFDt+%2FAdHTEQCqU3tg%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | PalmettoSign in with LinkedInVP, Talent ManagementPalmetto United States (Remote)Posted 2 weeks agoFull-timeHuman ResourcesIT Services and IT ConsultingRenewable Energy Semiconductor ManufacturingApplyMeet the hiring teamThelma Patricia PayneTalent Partner | Sr. Recruiter | Passionate About Clean Energy ☀️ & Diversity! 🌈Job PosterAbout the jobCompany DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleDo you thrive on change? Do you love working without structure and the confines of red tape? Do you enjoy a fast-paced environment, creatively solving problems, with multiple priorities?The People and Culture HR function is at an inflection point and we’re building out a world-class HR team for Palmetto. A critical part of this buildout is our VP, Talent Management role, a key piece of being our best for our employees by creating an incredible work environment and for our customers. In this exciting role, you will define and establish our company’s future talent approach in partnership with the executive team.If this sounds like an exciting adventure, keep reading!Palmetto is seeking an exceptional HR leader to help design and build a people-centric Talent Experience function for our rapidly growing company. We value customer mindset, inclusion & diversity, rituals, longevity, happiness, and openness, and would like to see this function align and scale with these values first. With a focus on process improvement, you will champion our culture and drive talent strategies around onboarding, DEI, talent data & analysis, compliance, recognition & rewards, and employee engagement. This VP, Talent Management will report directly to our EVP, People & Culture.Strategic & TacticalBuild & drive the Talent Development strategy. Identify and develop a learning philosophy and culture for the organization. Partner with team members in the execution of the tactical components of talent development.Design an effective implementation strategy from talent review and succession planning to full employee lifecycle attraction, retention, and development.Define consistent and relevant talent management, organization development, learning success criteria, and performance metrics to ensure program efficiency, effectiveness, and return-on-investment value and identify enterprise gaps.Influence and present data-driven effectiveness to senior leadership regarding the adoption and performance of talent management, organization capability, and learning programs to promote the achievement of business strategy and accelerate change.Collaborate closely with internal partners and stakeholders to align the talent and learning function to ensure a seamless, effective service experience for employees and managers.Manage the performance of the talent management team to ensure they’re delivering consistent services that align with business strategy, using our technology and focusing on process optimization.Partner on all areas of Inclusion & Diversity for Palmetto, including working closely with Talent Acquisition, the broader HR team, and key stakeholders throughout the company.QualificationsHighly flexible, agile, collaborative, and effective at leading and delivering on business imperatives in a high-change, high-growth environmentOperational and strategic thinker with excellent knowledge in change management, organizational design, and talent performance management to bring innovation to the organizationBusiness acumen paired with a hands-on mentality and the ability to match business needs with HR deliverablesAnalytical and data-driven, with the ability to integrate complex data into insights to create future-focused, high-impact people business strategiesExcellent communicator, with experience in coaching, engaging and influencing senior business leadersBachelor’s Degree or equivalent experience in progressive talent management.A minimum of 15+ years of senior-level business leadership experience, including team development and management in a large and complex organization, is required.Previous industrial psychology or organizational development focus, a plus.Experience designing, developing, and supporting organization-wide talent management, performance management, and training & development.Demonstrated success operating in a consultative role at the executive level and building relationships within all levels of the organization.Excellent communication skills, organizational and negotiation skills, with a keen focus on delivering business results.Proven consulting skills and demonstrated ability to work in a team environment, as a team leader and member.Ability to work well with others in a fast-paced, dynamic environment.Ability to be respectful, approachable, and team-oriented while building strong working relationships and a positive work environmentEmployment is contingent upon the successful completion of a background check.Equal Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.Talent ManagementAnalytical SkillsPerformance ManagementStrategic ThinkingCommunicationOrganizational DevelopmentBusiness StrategyLeadershipChange ManagementTraining & DevelopmentFeatured benefitsEmployer-providedMedical insurance, dental insurance, vision insurance, paid maternity leave, paid paternity leave, student loan assistance, tuition assistance, and disability insuranceLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3364427932?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=N+4jrylZzPUFgq9x6gG8kw%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | PalmettoSign in with LinkedInElectrician (Midwest)Palmetto Pittsburgh, PA (On-site)Posted 2 months agoFull-timeManufacturingIT Services and IT ConsultingRenewable Energy Semiconductor ManufacturingApplyMeet the hiring teamCourtney Tutt KochelTalent Acquisition CoordinatorJob PosterAbout the jobCompany DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleResponsible for providing the technical expertise to safely plan and perform electrical work for residential solar projects while coordinating residential installs of each system efficiently, in a timely and quality manner.This individual will be a strong contributor to our installation team. With room to grow and competitive pay, you will be responsible for installing, maintaining, servicing main panel upgrades, and troubleshooting electrical components of our residential solar projects.Strategic/Tactical ResponsibilitiesCommunicate the necessary job status data to the Crew Lead to ensure the successful completion of solar arrays/systems installationsWork with crew and complete all portions of Photovoltaic systems installs (PV) including passing panels, conduit pipe, attic conduit runs, passing PV panels to the roof and roof pipe when requiredFollowing all safe working practices for the Palmetto installation teamResponsible for safe and correct installation of PV systems and electrical workAssemble all components of a residential solar systemEnsure that the work is performed in a neat and workmanlike manner and compliant with all State, local, and utility codes and standardsDiagnose and troubleshoot system components to resolve electrical (DC and AC) issuesFollow OSHA, NEC, AHJ, and Utility requirementsProvide top-notch customer service throughout the installationUpload photos and update job status in the company database when work is completeStrong knowledge and experience of conduit bending (EMT) and ability to produce consistentlyPerform other related duties as assignedRequired Background and SkillsHigh school diploma, GED, or equivalentValid and current Electrician License within the stateExperience with Battery backup systemsMinimum 3 years of electrical installation and repair experienceAbility to drive a vehicle during the normal course of business. Must maintain a clean driving record with the ability to pass a driving background checkWorking knowledge of current NEC codesMust have working knowledge and experience replacing residential electrical services and distribution panelsAbility to effectively manage work to achieve required timelinesPerform installs services on sides of home and interior spacesEmployment is contingent upon the successful completion of a background check.Equal Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.Tube BendingCustomer ServiceElectricityPipeCommunicationElectrical WiringOSHAElectrical ConduitsPVTroubleshootingFeatured benefitsEmployer-providedMedical insurance, dental insurance, vision insurance, paid maternity leave, paid paternity leave, student loan assistance, tuition assistance, and disability insuranceLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3437820798?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=1Qw75XOGAAPP4qi8V6fHKg%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | PalmettoSign in with LinkedInSenior Analytics & Data DirectorPalmetto United States (Remote)Posted 2 weeks agoFull-timeCustomer ServiceIT Services and IT ConsultingRenewable Energy Semiconductor ManufacturingApplyMeet the hiring teamCourtney Tutt KochelTalent Acquisition CoordinatorJob PosterAbout the jobCompany DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleAs the Senior Director, Data & Analytics, you will lead Palmetto’s centralized Data & Analytics team, and guide the team to deliver the data and insights that Palmetto’s business teams use to inform, launch, monitor, and optimize new and existing initiatives, processes, and goals. You will enable and evangelize data-driven decision-making for our business. You are comfortable diving into an ever-evolving cloud data warehouse, writing SQL queries that answer stakeholder (and your own) questions, building visualizations to make those findings digestible and productionalized, and communicating those insights out. You are comfortable partnering with Product teams and our Data Engineering team to guide on Product Data Models that can inform downstream BI needs. The successful candidate will possess a passion for innovative analysis, processes that scale, and the wherewithal to develop findings and recommendations that tie the data and numbers back to the real world.Strategic & TacticalManage a small team, and enable a business partner model with business teams that create an intake and prioritization process, being the central owner of Data & Analytics needs across the business.Oversee the team’s development of advanced dashboards and reports for the ongoing analysis and monitoring of our partners, markets, KPIs, OKRs, and other initiativesConduct ad-hoc analysis with rapid delivery to support key tactical decisionsCollaborate closely with Palmetto’s data community in order to better understand upstream data processes and work together on company-wide initiativesWork closely with project managers to understand their analytical needs, including identifying critical metrics and KPIs, and delivering actionable insights to relevant decision-makersWrite clean code, investigate and correct errors, identify, and contribute to the data infrastructure (e.g., snowflake, dbt).QualificationsMBA (or relevant experience) with 8-10 years of experience in data analysis, data science, or data warehousing with proven business analysis experience: you thrive on combining rigorous data-driven analysis, strong business intuition, and judgment, and an ability to work well across a variety of teams to solve complex problems.Impact Orientation: You have the ability to translate quantitative data into actionable business insights and recommendations. Ability to communicate complex data concepts and reasoning in ways that product teams, senior management, and the wider organization will understand.Data Fluency: Quantitative analysis and logical reasoning; 5+ years of experience using SQL and visualization tools on large data sets to extract trends and insights.Efficiency: Excellent organizational and prioritization skills as demonstrated by experience driving multiple, competing projects under deadline pressure.Enthusiasm: You’re passionate about Palmetto’s mission and excited to bring clean, renewable solar energy to more people.Even BetterFamiliarity with Palmetto’s data stack and other core tools: SQL, Jira, Looker, Tableau, GitHub, dbt, Snowflake, SalesforceFamiliarity with ETLs and data modeling concepts (e.g. star, noSQL)Comfortable with many aspects of the data ecosystem (e.g. data modeling, defining metrics, visualization, analysis, communication, and implementation)Experience working at a dynamic and rapidly growing company, preferably in technology, energy, or the construction industryIf you find building, collaborating on, and learning about a new data model exciting, this could be the opportunity for you!Employment is contingent upon the successful completion of a background check.Equal Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyUpdated 9/8/22: HTShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.Analytical SkillsSQLData AnalysisBusiness AnalysisData ModelingBusiness InsightsAnalyticsDialectical Behavior Therapy (DBT)TableauProject ManagementFeatured benefitsEmployer-providedMedical insurance, dental insurance, vision insurance, paid maternity leave, paid paternity leave, student loan assistance, tuition assistance, and disability insuranceLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3514711465?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=E67asY7a8xXVlyHtIQ9cCA%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | PalmettoSign in with LinkedInExecutive AssistantPalmetto Charlotte, NC (Remote)Posted 1 month agoFull-timeAdministrativeIT Services and IT ConsultingRenewable Energy Semiconductor ManufacturingApplyMeet the hiring teamThelma Patricia PayneTalent Partner | Sr. Recruiter | Passionate About Clean Energy ☀️ & Diversity! 🌈Job PosterAbout the jobCompany DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, paid parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleAs an Executive Assistant at Palmetto, you will provide high-touch administrative support for the Corporate, Technology, Revenue, and/or Operations leaders who need additional support for tactical and strategic initiatives. Your outstanding organizational skills and your ability to anticipate needs will play a key role in helping our leaders effectively accomplish company initiatives and key tasks.Strategic & TacticalEffectively manage active calendars, ensuring schedules are followed and respected for the executivesBe the executives’ right hand by preparing agendas, attending important meetings, and taking notes, while ensuring executive preparation and effectivenessPrioritize conflicting needs, handle matters expeditiously and follow throughEffectively and consistently communicate with senior leadership teams on projects, and executive calendars, and provide backup support to other executive assistants as neededQualificationsThe ideal candidate will be located in the Charlotte, NC metropolitan areaProactive and forward-looking with strong organizational skills that reflect the ability to perform and prioritize multiple tasks seamlessly5+ years of C-level support in a fast-paced, ever-changing environmentClear communication skills with the ability to organize and prioritizeStrong interpersonal skills, approachable, and able to build relationships with stakeholders, including executives, team members, and external guests. Ability to ‘manage up’ to protect and prioritize the c-level leader’s time.Highly motivated, self-starter with exceptional attention to detail and a high degree of accuracy in work outputProficiency with Google Suite (G-Mail, Calendar, Sheets, Docs, Etc.), Zoom, Slack, and the ability to quickly learn other software and toolsEqual Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.CalendaringLogistics ManagementTime ManagementC-Level Executive SupportExecutive Administrative AssistanceSkilled Multi-taskerOrganization SkillsCalendarsInterpersonal SkillsStrategic InitiativesFeatured benefitsEmployer-providedMedical insurance, dental insurance, vision insurance, paid maternity leave, paid paternity leave, student loan assistance, tuition assistance, and disability insuranceLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3467044318?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=Z9uFDicfBDqdxPIzfwyz%2Fg%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | PalmettoSign in with LinkedInService Operations AnalystPalmetto United States (Remote)Posted 1 month agoFull-timeCustomer ServiceIT Services and IT ConsultingRenewable Energy Semiconductor ManufacturingApplyMeet the hiring teamCourtney Tutt KochelTalent Acquisition CoordinatorJob PosterAbout the jobCompany DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleThe Service Operations Analyst role is critical to the success of the Palmetto Platform, managing all customer and operational logistics around one of the most impactful customer moments on their clean energy journey – ongoing services and support needs throughout the 25+ year lifespan of the solar system.The Service Operations Analyst is responsible for assisting customers, B2B channel partners, and Tier 1 Customer Support reps in solving services and support cases. They are also responsible for investigating elevated tickets by confirming the validity of the problem and seeking known solutions.The Service Operations Analyst is able to prioritize the troubleshooting process and properly manage time. This may include solar repair, diagnostic testing, and the utilization of remote monitoring tools.The initial troubleshooting and triage is just the beginning, as the Service Operations Analyst is also responsible for scheduling Build Partner or internal Field Service Tech appointments with customers. They must communicate empathetically with customers and form strong relationships with Build Partners to ensure seamless scheduling.Strategic & TacticalTriage, troubleshoot, and schedule service appointments.Ensure customer service levels meet or exceed Palmetto standards.Ensure all queues are meeting the defined SLAs (Service Level Agreements).Manage all queues, reports, and cases within company CRM platforms.Get final quotes and invoices from Services partners; manage initial project cost.Maintain proactive, customer service-oriented communication with residential clients regarding project status along defined benchmarks to aggressively drive backlog projects through the pipeline and onto the schedule.Communicate with region-based Palmetto Operations Managers regarding resource management, schedule construction, and specific job details.Escalate any jobs stuck or delayed beyond the normal timeline.Lead collaborative efforts as an interdepartmental liaison amongst sales, survey, engineering, supply chain, and regional management staff to resolve conflicts and inefficiencies before they arise.Take on new tasks and responsibilities as needed to help the Services division achieve its goalsSeek constant improvement in the quality of Palmetto’s products and customer service.QualificationsBS/BA Preferred.Minimum 2 years of experience in a customer, tech, or sales support role preferredA high degree of proactiveness, adaptability, and resourcefulness to excel in a dynamic, fast-paced environmentCustomer service mindsetProblem solver with attention to detailStrong enterprise software skills (G Suite, Salesforce, Zendesk)Ability to work independently as well as in a teamExcellent communicator, both written and verbalKnowledge of the construction or solar industry preferredSpanish proficiency is a plusEmployment is contingent upon the successful completion of a background check.Equal Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.SpanishService-Level Agreements (SLA)Service OperationsZendeskProject ManagementCustomer Relationship Management (CRM)Customer ServiceTroubleshootingTime ManagementCustomer SupportFeatured benefitsEmployer-providedMedical insurance, dental insurance, vision insurance, paid maternity leave, paid paternity leave, student loan assistance, tuition assistance, and disability insuranceLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3482564137?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=emsKvQjVp+MlaDV1ozqpeQ%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | PalmettoSign in with LinkedInSales Representative Experience (Sx) Program ManagerPalmetto Charlotte, NC (Hybrid)Posted 4 days agoFull-timeSalesIT Services and IT ConsultingRenewable Energy Semiconductor ManufacturingApplyMeet the hiring teamThelma Patricia PayneTalent Partner | Sr. Recruiter | Passionate About Clean Energy ☀️ & Diversity! 🌈Job PosterAbout the jobCompany DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleIn this role, you will partner with the Director and team of Sales Representative experience managers to develop best practices that scale for the Sales Representative Experience team network, with a primary focus on Sales Representative retention and success. This is the launch of fee-based services for Sales Representatives to provide thorough, white-glove concierge services.Strategic & TacticalDefine, develop, implement, and drive the adoption of SOPs and best practices for the SX roleResponsible for documenting, training, and continuous education across the teamResponsible for executing experiments with a data-driven approach and incubating new processes prior to rolling out at scaleBe a player/coach. Ability to oversee individual projects while also adopting process improvements.Serve as an external point of contact for potential partnerships. Ability to showcase our services and educate external parties on our detailed SOPsDevelop project escalation management for the teamPartner with the Customer Lead Directors to ensure alignment across key processes (such as change orders, and cancellations)Work closely with the SX Director for adoption and performance metrics across the teamPartner with Product and other Customer Experience teams to standardize tools and systems and provide product feature requests and gap analysis.Qualifications4-6 years experience defining and executing processes in sales, operations, or customer experience roleDedicated to continuous improvement and a love of processExperience partnering with product and tech to scale SOPs and provide input to product roadmapsExperience developing success metrics and measuring process improvementAbility to adapt to change quickly and adapt to new tools or processesExperience in the solar industry is preferred but not requiredEmployment is contingent upon the successful completion of a background check.Equal Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.Solar IndustrySalesProject ManagementPerformance MetricsCustomer ExperienceStandard Operating Procedure (SOP)Program ManagementAnalytical SkillsSolar EnergyCustomer ManagementFeatured benefitsEmployer-providedMedical insurance, dental insurance, vision insurance, paid maternity leave, paid paternity leave, student loan assistance, tuition assistance, and disability insuranceLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3522212237?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=ryr6tOgP9+EMI1hSRLx5Bg%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | PalmettoSign in with LinkedInFleet Performance & Monitoring AssociatePalmetto United States (Remote)Posted 1 month agoFull-timeCustomer ServiceIT Services and IT ConsultingRenewable Energy Semiconductor ManufacturingApplyMeet the hiring teamCourtney Tutt KochelTalent Acquisition CoordinatorJob PosterAbout the jobCompany DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleThe Fleet Performance & Monitoring Associate will ensure that Palmetto’s fleet of solar energy systems is healthy and operating efficiently. The Associate will achieve this by leveraging internal and third-party tools to activate and remotely monitor each system’s performance. When a potential issue is detected, they will help proactively diagnose it and work closely with the customer, CX, sales, and service fulfillment to resolve it. As part of the resolution process, they will work with Palmetto’s suppliers to return and/or replace malfunctioning components (e.g., inverters). The Associate will provide recommendations to make the monitoring and resolution processes faster, easier, and more cost-efficient. The Associate will also act as a technical expert to help troubleshoot technical issues live with customers via the phone as they arise. The role is vital to resolving issues as quickly as possible, and as much as possible, before the customer even alerts us of an issue.Strategic & TacticalReview fleet system performance daily to identify any major issues and/or system failures.Diagnose issues and contact customers to inform them of any issues and advise on the next steps.Collaborate closely with the Palmetto Sales, Customer Experience, and Service teams to solve customer needs.Create cases to track system performance issues and equipment failure via SolarEdge / Enphase case tracking and Salesforce systems.Work with the Customer Experience team to remotely diagnose and resolve customer issues in real-time over the phone.Develop a deep understanding of SolarEdge, Enphase, and other inverter monitoring software to enable remote troubleshooting and issue diagnosis, and to identify when to activate an on-site technician visit. Become the company subject matter expert on remote monitoring.Identify process improvement opportunities that can save customers, suppliers, service providers, and Palmetto time, money, and effort. Opportunities could relate to the number of on-site visits needed to resolve issues, the management of inventory, etc..Act as a sounding board for Palmetto’s technology team as they build tools to help you and our customers identify and resolve issues more quickly.Help to onboard and integrate new monitoring systems for various products and third-party services.Manage the return merchandise authorization (RMA) process for Palmetto’s fleet of install and service customers.Take on new tasks and responsibilities as needed to help the Services division achieve its goals.QualificationsBS/BA Preferred3+ years overseeing logistics and/or fleet operationsTechnical understanding of residential solar energy systems and field experience in solar energy operations preferredCreative problem-solving skills; ability to understand complex problems and logically troubleshoot and work through themOral and written communication skills to interact with customers, vendors, cross-functional partners, and field partnersHighly organized with strong attention to detail; ability to multitask, prioritize, and manage multiple customer cases at onceStrong collaboration capabilities across sales, operations, CX, and other departments to resolve customer issuesAbility to work independently and drive your goals forwardA high degree of proactiveness, adaptability, and resourcefulness to excel in a dynamic, fast-paced environmentEmployment is contingent upon the successful completion of a background check.Equal Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.Written CommunicationCreative Problem SolvingRMADiagnoseResolving IssuesSkilled Multi-taskerCXProblem SolvingProject ManagementCustomer ManagementLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3482563246?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=fsvUtD8KhGHmwnxF6Tt13Q%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | PalmettoSign in with LinkedInSenior Customer Success ManagerPalmetto United States (Remote)Posted 1 month agoFull-timeCustomer ServiceIT Services and IT ConsultingRenewable Energy Semiconductor ManufacturingApplyMeet the hiring teamThelma Patricia PayneTalent Partner | Sr. Recruiter | Passionate About Clean Energy ☀️ & Diversity! 🌈Job PosterAbout the jobPalmetto is constantly hiring! This posting is for future Senior Customer Success Manager opportunities as they come available. By applying, you will be submitting your resume into our pool of candidates for future opportunities.Company DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleThis role is responsible for executing the strategic vision and maximizing the lifetime value of our enterprise and utility partners. Our partnerships are varied and expanding, from lead referral and employee benefit programs to turnkey solar enablement and decarbonization. Reporting to the VP of Customer Success, you will be “the face of the business” and the main POC to these B2B, B2B2C, and utility clients across North America.You will act as the quarterback for all post-sale activities. You are a true “team player” orchestrating cohesive action plans across multiple internal groups such as technical account management, product/engineering, corporate sales, CX, and operations. Maniacally focused on metrics, you continuously set a high standard of success for yourself and your customers. You exude a strong executive presence, can speak to Palmetto’s value proposition with ease, and are comfortable communicating and building relationships with C-level clients. You are a creative, out-of-the-box thinker, and your voice will be instrumental in shaping the programmatic evolution of the Customer Success team. Finally, you are a mission-driven individual, passionate about creating a better world for future generations, and will stop at nothing to see that vision realized.Strategic & TacticalEnforce the deliverables and milestones of the partner-customer journey, from intake to onboarding, through implementation, program launch, and ongoing support and engagementDesign and execute programs intended to meet our partner’s growth, customer experience, and product/tech requirementsAlign closely with technical counterparts to drive and oversee product enablement and adoption of the Palmetto tech platformsOwn relationship management within the accounts, building horizontal and vertical frameworks that will help us secure buy-in, drive urgency, uplevel conversations, mitigate churn risk, and expand into untapped business unitsBuild strategic success plans and drive projects that maximize value realization based on the partner’s corporate goalsRun periodic business reviews aimed at documenting key milestones and opportunities for collaboration according to the client’s agreed-upon success criteriaShare best practice and benchmarking metrics with partners, challenging them to be best-in-class and industry competitive with their peersPartner with corporate sales on growth and marketing opportunities within the account, including seller enablement and new market launchesCollaborate with customer and product marketing teams to advocate and demonstrate your partner’s success to the market, including case studies, video testimonials, references, white pages, speaker engagements, communities, VOC interviews, and advisory boardsContribute to the betterment and longevity of the team by providing feedback, training new hires, and offering solutions for process improvementQualifications5-7 years minimum experience managing Fortune 100, enterprise-level clients in B2B software or tech industriesProven track record of success with the metrics and performance indicators listed aboveHighly experienced in project managing internal and external initiatives, PMP certification a plusExcellent presentation, communication, and organizational skillsComfortable working with fast-paced, agile software teams, and interacting with PM software such as Miro, Trello, or Monday.comUnderstanding of solar, renewable, electrification or clean tech industries is a plusComfortable working in a startup-style environment with an enterprise-scale visionChallenges the status quo and adapts to changeAble to travel as needed (at minimum quarterly) to conduct on-site visits with partnersProximity to the intended client is a plusEqual Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.Advisory BoardsStrategic VisionProject ManagementRelationship BuildingVoice of the CustomerDocumentationCustomer ExperienceCXCustomer SuccessAccount ManagementFeatured benefitsEmployer-providedMedical insurance, dental insurance, vision insurance, paid maternity leave, paid paternity leave, student loan assistance, tuition assistance, and disability insuranceLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3469834158?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=tIkigQjoOnTbb4chGW71bQ%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | PalmettoSign in with LinkedInSenior Executive AssistantPalmetto Charlotte, NC (Remote)Posted 2 weeks agoFull-timeAdministrativeSoftware DevelopmentApplyMeet the hiring teamHilary ThompsonSenior Talent Acquisition Manager at PalmettoJob PosterAbout the jobCompany DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, paid parental leave, and retirement plans.Summary of RoleAs an Executive Assistant at Palmetto, you will provide high-touch administrative support for the Corporate, Technology, Revenue, and/or Operations leaders who need additional support for tactical and strategic initiatives. Your outstanding organizational skills and your ability to anticipate needs will play a key role in helping our leaders effectively accomplish company initiatives and key tasks.Strategic & TacticalEffectively manage active calendars, ensuring schedules are followed and respected for the executivesBe the executives’ right hand by preparing agendas, attending important meetings, and taking notes, while ensuring executive preparation and effectivenessPrioritize conflicting needs, handle matters expeditiously and follow throughEffectively and consistently communicate with senior leadership teams on projects, and executive calendars, and provide backup support to other executive assistants as neededPlan and assist with planning team meetings and corporate eventsWork closely with the executive leaders to manage relationships with internal and external stakeholdersAssist Executive with special projects, which will include preparing presentations and researching and analyzing dataQualificationsMust be located in the Charlotte, NC metropolitan area (or willing to relocate)Proactive and forward-looking with strong organizational skills that reflect the ability to perform and prioritize multiple tasks seamlessly8+ years of C-level support in a fast-paced, ever-changing environmentClear communication skills with the ability to organize and prioritizeStrong interpersonal skills, approachable, and able to build relationships with stakeholders, including executives, team members, and external guests. Ability to ‘manage up’ to protect and prioritize the c-level leader’s time.Highly motivated, self-starter with exceptional attention to detail and a high degree of accuracy in work outputProficiency with Google Suite (G-Mail, Calendar, Sheets, Docs, Etc.), Zoom, Slack, and the ability to quickly learn other software and toolsEmployment is contingent upon successfully passing a background check.Equal Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.Organization SkillsAppointment SchedulingC-level supportCommunicationAdministrative AssistanceGoogle WorkplacePresentationsExecutive Administrative AssistanceInterpersonal SkillsCalendarsLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3510691455?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=Ds+enPFthzhE5X1wdYfCAQ%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | PalmettoSign in with LinkedInField Operations Director, WestPalmetto United States (Remote)Posted 2 weeks agoFull-timeCustomer ServiceIT Services and IT ConsultingRenewable Energy Semiconductor ManufacturingApplyMeet the hiring teamThelma Patricia PayneTalent Partner | Sr. Recruiter | Passionate About Clean Energy ☀️ & Diversity! 🌈Job PosterAbout the jobCompany DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleThe Field Operations Director will lead operational oversight and effectiveness through Installation Managers, Install Supervisors, and Electrical Managers across roughly a half dozen states, with responsibility for a customer’s project from Install Ready to Inspection Complete. This role is accountable for ensuring the efficient operation of market teams by identifying and removing impediments to throughput across a cross-functional landscape, collaborating with Operations & Installations Managers and other operations counterparts to simplify and automate processes, accelerate cycle times, exceed KPIs, and improve cross-market outcomes.Strategic & TacticalDrive territory and market-level initiatives to improve build costs, timelines, and best-in-class installation quality.Collaborate with the central Build and Quality teams to improve Partner onboarding and qualityOversee 12-month rolling market level build capacity to ensure oversupply in each operational Palmetto Service AreaLead a high-performing team of field operations personnel focused on goal attainmentDevelop and drive strategic initiatives to address pipeline-blocking circumstancesDrive cross-departmental collaboration to create efficiencies in the post-install pipeline.Collaborate with the Customer Lead organization to ensure industry-leading timelines and customer experience.Partner with technology to enhance team efficiency and processesQualifications8-10+ years of operational leadership experience with a demonstrated track record of process improvement and leadership capability.5+ years experience in managing multiple manager-level teams via metrics and KPIs.Thorough understanding of the rooftop solar life cycle requirements from sale through PTOTrack record managing interdepartmentally to meet and exceed key operational and customer experience metrics.Demonstrated leadership capabilities in a fast-paced, change-oriented environment.Excellent organizational skills and ability to prioritize.Excellent analytical skills.BA/BS in a related discipline or equivalent combination of education and experience.Employment is contingent upon the successful completion of a background check.Equal Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.Operations ManagementSolar IndustryTerritory ManagementStrategic InitiativesField OperationsOrganization SkillsProject ManagementProcess AutomationCustomer ExperienceRenewable EnergyFeatured benefitsEmployer-providedMedical insurance, dental insurance, vision insurance, paid maternity leave, paid paternity leave, student loan assistance, tuition assistance, and disability insuranceLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3452504278?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=SJlkkvFXzT5Eg2aqUtX+EA%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | PalmettoSign in with LinkedInPrincipal EngineerPalmetto United States (Remote)Posted 3 days agoFull-timeEngineeringRenewable Energy Semiconductor ManufacturingSoftware DevelopmentApplyMeet the hiring teamCourtney Tutt KochelTalent Acquisition CoordinatorJob PosterAbout the jobCompany DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleWe are looking for a passionate principal full-stack engineer proficient with the MERN stack (MongoDB, Express, React.js, Node.js) and the Ionic Mobile framework. You will be an integral part of a multi-dimensional team responsible for the full software development life cycle of our platform. As a member of the Palmetto Engineering team, you’ll be working in an Agile development environment with a team that prides itself on innovation, is focused on product development, and doesn’t shy away from solving difficult business problems.We’re looking for someone who is energetic, self-motivated, team-oriented and enjoys being a key contributor in an entrepreneurial environment. You’ll work alongside – not for – UX designers, product managers, and other engineering team members. This isn’t a task-receiving role; we want your hands, brains, and heart to make solutions and shape the platform’s future.Strategic & TacticalDesign both client-side and server-side architecturesDevelop and manage well-functioning applications and databasesWrite comprehensive E2E and unit tests to verify functionalityTroubleshoot, debug, and upgrade softwareCollaborate across teams to identify and develop best practices, design patterns, and reusable codeParticipate in product discovery, architectural design, and rapid iteration of featuresActively participate in code reviews and provide constructive feedback to safeguard product qualityWork closely with Product to validate solutions feasibilityCraft solutions that satisfy near-term objectives while enabling future growth and scalabilityQualificationsMobile Experience using React Native or Ionic frameworksExperience designing and consuming RESTful APIsStrong proficiency in JavaScript, including DOM manipulation and the JavaScript object model10+ years of professional engineering experienceProfessional experience with Node.js3+ years of relevant working experience using popular React.js workflows (such as Flux or Redux) and databases (e.g., MongoDB, PostgreSQL)Excellent written and verbal communication skillsA desire to never stop learning, a deep passion for technology, and a collaborative mindset to work with others to ensure end-to-end design and deliveryA strong work ethic, exceptional problem-solving skills, and an interest in tackling diverse technical challenges. Design and develop quality code that follows best practices and adheres to Palmetto standardsOpenness to collaboration through formal and informal code and PR review processesPreferred QualificationsExperience with ES6+ language featuresExperience with data structure libraries (e.g., Immutable.js)Professional experience in React and isomorphic React is a plusKnowledge of modern authorization mechanisms, such as JSON Web TokenFamiliarity with modern front-end build pipelines and toolsExperience with at least one common development tool such as Babel, Webpack, NPM, Yarn, etc.Ability to understand business requirements and translate them into technical requirementsA knack for benchmarking and optimizationFamiliarity with code versioning tools such as GitExperience with agile development practices, TDD, and pair-programmingEmployment is contingent upon the successful completion of a background check.Equal Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.PostgreSQLNode.jsIonic FrameworkREST APIsReact NativeJavaScriptMongoDBRedux.jsGitReact.jsLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3524253328?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=poh2ejqeMCUpEZqLw1ARFQ%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | PalmettoSign in with LinkedInAppointment SetterPalmetto Charlotte, NC (Hybrid)Posted 3 weeks agoFull-timeCustomer ServiceIT Services and IT ConsultingRenewable Energy Semiconductor ManufacturingApplyMeet the hiring teamCourtney Tutt KochelTalent Acquisition CoordinatorJob PosterAbout the jobCompany DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleThe Appointment Setter position will be responsible for creating revenue-based performance by setting appointments for the sales teams. The appointments will also be generated for the Inside Sales team for opportunities.This role will play a critical role in driving key operational metrics and focusing heavily on achieving key company goals for Gross Mercantile Value (GMV) and Revenue.Strategic & TacticalDrive revenue growth through multiple avenues: setting quality appointments for our Inside Sales teamPractice appointment setting efficiency and objection handlingStay up to date on all Palmetto products, services, and pricingUnderstand the sales members who we are setting appointments for so that proper expectations are setHave an understanding of Market and Customer needsFlag areas of bottlenecks or improvements to team managerIdentify improvement and development sales opportunitiesRespond to incoming leads in less than 5 minutesAnswer all call-ins and log appropriately in CRMCommunicate with appropriate Enterprise/Pro Members; providing needed information to effectively execute our sales strategyFollow up on set appointments for QA/QC and as-needed redistributionFollow the Inside Sales process through completion with high integrityManage customer follow-up lists and update customer reports to reflect activityEnsure customer information is complete and accurate and maintain good follow-up practicesBe prepared to discuss specific customer issuesLog all feedback and notes in Salesforce when necessaryOpen & close leads and correctly update the status of leads in SalesforceFollow the golden rule “if it isn’t logged properly, it never happened”Qualifications1 to 2 years of sales experience or related work history with a custom interactionExcellent customer service skills.Strong conflict resolution skills.Enjoys working in a fast-paced rapidly changing environmentCustomer service mindsetAttention to detailStrong computer skills (G Suite)Ability to work independently as well as in a teamExcellent communicator, both written and verbalKnowledge of the construction or solar industry preferredSpanish speaker is a plusEmployment is contingent upon the successful completion of a background check.Equal Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.Revenue GenerationAttention to DetailSpanishCustomer ServiceSalesforce.comSales ProcessesCustomer Relationship Management (CRM)Conflict ResolutionComputer LiteracySetting AppointmentsFeatured benefitsEmployer-providedMedical insurance, dental insurance, vision insurance, paid maternity leave, paid paternity leave, student loan assistance, tuition assistance, and disability insuranceLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3491994748?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=kHvV6173dkVRBy+4sOeiDw%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Malaria Consortium | The VacancyThe CompanyWhat We DoDocumentsHealthCommunityResponseDigital Health SpecialistSalary56,825LocationMaputo This is a permanent, full time vacancy that will close in 10 days at 23:59 GMT.The VacancyMalaria Consortium is recruiting for a Digital Health Specialist to join our team in Maputo, Mozambique. The Digital Health Specialist will be responsible for capacity building provincial and national government stakeholders on the management of the upSCALE platform, as well as providing leadership and technical guidance in relation its development and integration with other national systems.The successful candidate will have:EssentialMaster’s degree in relevant field (information systems, computer science).Extensive years of experience, with at least 2-3 years’ experience in implementing digital solutions, preferably in the health system.Previous experience of capacity building and providing technical assistance regarding the implementation of digital solutions to stakeholders at various levels including but not limited to government actors, international organizations, NGOs/CBO’s, healthcare providers and community level structures.Experience of developing Android applications and complex data collection forms.Experience in system administration and hardware management.Experience in integrating information management systems.Experience of developing dashboards for data visualisation and analysis.DesirableExperience and understanding of the Mozambique health systems context both at central and provincial levels, particularly the APE programme.Familiar with monitoring and evaluation of digital health interventions.Strong knowledge and experience working with CommCare and DHIS2.Experience in establishing community health information systems.Experience in server set-up.We need to keep beneficiaries safe so our selection process reflects our commitment to safeguarding. Please find our Code of Conduct, Safeguarding Policy and Privacy Notice here. Due to the nature of this role we will be reviewing applications on an ongoing basis and the role might be filled and closed before the closing date. Early applications are encouraged.The CompanyEstablished in 2003, Malaria Consortium is one of the world’s leading non-profit organisations specialising in the prevention, control, and treatment of malaria and other communicable diseases among vulnerable populations.Our mission is to save lives and improve health in Africa and Asia through evidence-based programmes that combat targeted diseases and promote Universal Health Coverage.What We DoWe are dedicated to ensuring our work is supported by strong evidence and remains grounded in the lessons we learn through implementation. We explore beyond current practice, to try out innovative ways – through research, implementation, and policy development – to achieve effective and sustainable disease management and control. DiseasesRead about thisAdvocacyRead about thisResearchRead about thisLearningRead about thisBelow are some useful links to check out:Policies & ProceduresFAQsDocumentsJD Digital Specialist Revised March 2023.pdf – DownloadYour Email AddressApply NowAlternatively, sign-in with… Google LinkedIn FacebookPublished5 days agoClosingin 10 days Share This Vacancy | https://malariaconsortium.current-vacancies.com/Jobs/Advert/3048537?cid=2061&t=Digital-Health-Specialist |
| The Good Food Institute | Skip to ContentPlant-basedCultivatedFermentationAboutTeamGlobalCareersMediaBlogScienceIndustryPolicySolutionsInitiativesEngageDonateStay inthe loopNAME* FIRST LASTPROFESSIONAL BACKGROUND*EntrepreneurFood industryGovernment / public officialInvestorMediaScientist / researcherStudentOther / Prefer Not To SayEMAIL*As a subscriber, you’ll receive the biweekly Reimagining Protein newsletter as well as occasional updates and opportunities to support and get involved in our work. You may unsubscribe at any time. Please see our Privacy Notice for more details on how we store and use your information.Check out GFI’s full suite of newsletters.PHONEThis field is for validation purposes and should be left unchanged.GFI newslettersEssentialsGFI in the newsExpertsWork at GFIGlobalDonatePrivacy policyContact usCopyright 2023. All Rights Reserved. Powered by philanthropy, GFI is a nonprofit 501(c)(3) organization. Tax ID 81-0840578We use cookies on our website to give you the most relevant experience by remembering your preferences and repeat visits. By clicking “Accept”, you consent to the use of ALL the cookies. Privacy noticeCOOKIE SETTINGSREJECTACCEPT | https://gfi.org/job/?gh_jid=6667352002 |
| Palmetto | PalmettoSign in with LinkedInCustomer Experience DirectorPalmetto Charlotte, NC (Remote)Posted 2 weeks agoFull-timeCustomer ServiceIT Services and IT ConsultingRenewable Energy Semiconductor ManufacturingApplyMeet the hiring teamThelma Patricia PayneTalent Partner | Sr. Recruiter | Passionate About Clean Energy ☀️ & Diversity! 🌈Job PosterAbout the jobCompany DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleThe Director, CX Strategy will act as a strategic leader as well as manage the CX team and the day-to-day actions of Palmetto’s support functions. With an eye toward the development of a seamless digital support experience for all customer types, they will assist in the continued development of the customer’s voice, using data to communicate customer needs to the broader organization. The ideal candidate will be comfortable challenging the status quo, collaborating across different business units, working hand in hand with product and technology teams, and mentoring and developing a world-class, remote CX Team. The Director will also serve as a cultural driver, helping Palmetto continue to establish its standing as the client experience leader in the clean technology space.Strategic & TacticalDevelop short and long-term cx strategies in partnership with senior team members and provide the leadership necessary for the successful coordination, development, and execution of that strategyManage the CX P&L, negotiate and manage all vendor relationshipsBuild upon the existing data structure, and leverage the data within to focus and prioritize the organization’s consumer experience roadmap.Work with CX leadership to refine goals and metrics for measuring customer experience across the journey, including operationalizing NPS/CES and identifying key experience indicators based on desired customer outcomes.In partnership with other departmental leaders, continually optimize key customer-facing processes that differentiate Palmetto’s consumer experience, and provide opportunities for scale.Represent the voice of the customer and promote a customer-centric mindset across the organization. Develop internal training for all hires and represent the Voice of the Customer at company All Hands.Manage a team of CX specialists who act as the frontline of the customer’s voice and ensure teams deliver a seamless customer experience. Train, lead, and develop a team of CX experts with the skill sets needed to execute Palmetto’s CX strategy and iterate and refine it over time.Standardize Palmetto’s customer engagement strategy, including the development of recruitment standards, training, and internal process documentation.Focus on ticket deflection with a key KPI of reducing customer contacts. Use data to identify root-cause resolution of customer pain points. Articulate, verbally and in writing, complex decisions, trade-offs, and potential solutions clearly to leaders to help them understand customer experience-driven decision options and available options. Communicate cross-functionally to ensure all stakeholders are informed and needs are aligned.Qualifications8-10 Years in a strategic CX Role, with CX operations experience as wellExperience developing or implementing Voice of Customer (VoC) and/or Voice of Employee (VoE) programs and strategiesProven track record of working with Product teams to release new functionality to combat customer pain pointsAbility to influence senior leaders and colleagues to influence future consumer experiencesExperience working with a variety of CX vendorsEscalation management and experience handling emergency, high-touch issuesExperience in leading, mentoring, and developing high-performing teamsDemonstrated aptitude for innovation and creative development of differentiated customer experiencesBias for action, entrepreneurial mindset, and focus on growth and scaleAbility to manage multiple initiatives concurrently and ruthlessly prioritize the most impactful initiatives that maximize client valueAbility to manage ambiguity and tenacity when faced with obstaclesMetrics-driven mindset with advanced reporting skillsExperience with customer insights platforms is preferredEmployment is contingent upon the successful completion of a background check.Equal Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.Escalations ManagementStrategyProject ManagementVoice of the CustomerCustomer ExperienceCustomer EngagementCustomer InsightDocumentationCreative DevelopmentCommunicationFeatured benefitsEmployer-providedMedical insurance, dental insurance, vision insurance, paid maternity leave, paid paternity leave, student loan assistance, tuition assistance, and disability insuranceLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3456088818?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=8elHNZhCB5gVmMlmMbvzYQ%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| The Good Food Institute | Skip to ContentPlant-basedCultivatedFermentationAboutTeamGlobalCareersMediaBlogScienceIndustryPolicySolutionsInitiativesEngageDonateStay inthe loopNAME* FIRST LASTPROFESSIONAL BACKGROUND*EntrepreneurFood industryGovernment / public officialInvestorMediaScientist / researcherStudentOther / Prefer Not To SayEMAIL*As a subscriber, you’ll receive the biweekly Reimagining Protein newsletter as well as occasional updates and opportunities to support and get involved in our work. You may unsubscribe at any time. Please see our Privacy Notice for more details on how we store and use your information.Check out GFI’s full suite of newsletters.PHONEThis field is for validation purposes and should be left unchanged.GFI newslettersEssentialsGFI in the newsExpertsWork at GFIGlobalDonatePrivacy policyContact usCopyright 2023. All Rights Reserved. Powered by philanthropy, GFI is a nonprofit 501(c)(3) organization. Tax ID 81-0840578We use cookies on our website to give you the most relevant experience by remembering your preferences and repeat visits. By clicking “Accept”, you consent to the use of ALL the cookies. Privacy noticeCOOKIE SETTINGSREJECTACCEPT | https://gfi.org/job/?gh_jid=6658020002 |
| UK Government, Cabinet Office | Skip to main contentCookies on Civil Service JobsWe use some essential cookies to make this website work.To understand how you use Civil Service Jobs and improve the website we’d like to set some additional cookies.GOV.UK Civil Service JobsBETA Your feedback will help us to improve.Home Sign in / create an account Cymraeg People and Operations AdvisorCabinet OfficeApply before 11:55 pm on Tuesday 28th March 2023 DetailsReference number273419Salary£35,241 – £39,352Job gradeHigher Executive OfficerContract typePermanentBusiness areaCO – National Security SecretariatType of rolePolicyWorking patternFlexible working, Full-timeNumber of jobs available1ContentsLocationAbout the jobBenefitsThings you need to knowApply and further informationLocationLondonAbout the jobJob summaryAt the Cabinet Office we support the Prime Minister and Cabinet Office ministers in delivering the government’s key objectives. The Cabinet Office is both a “corporate centre” for government and a policy department in its own right that challenges, supports, leads and provides services to other Ministerial Departments. The Cabinet Office currently employs 6,000+ people who are in a variety of roles across the UK.COBR UnitThe COBR Unit leads the Government’s response to acute emergencies – domestic and international, malicious and non-malicious – and drives further professionalisation of emergency management within Government. The unit sits within the National Security Secretariat.The post in the Readiness and Response team in the COBR Unit provides an exciting opportunity to work at the centre of the Government’s emergency readiness and response programme.Operating across Government, your work will be key in driving readiness at both the national and local level for the biggest risks that threaten the UK. You will be part of a small team, working to enhance the UK’s short-term resilience, and leading the Government’s response to near-term crises as they arise.Job descriptionThis role sits on the strategy and planning function within the Readiness & Response team in the COBR Unit.This is an exciting opportunity to support, and lead on workforce and operational planning for both steady state and crisis response activities, across all thematic civil contingency desks.The key objectives are to:- Develop and maintain a Cabinet Office Crisis Cadre drawn from across Cabinet Office, by actively managing and promoting the scheme alongside delivering a number of events and engagements across the year.- Work with the Crisis Management Excellence Programme (CMEP) to identify and establish training requirements that build a network of appropriately skilled volunteers to support future crisis response.- Work with teams across Cabinet Office to workforce plan for large-scale preparedness activity, no-notice response and set piece exercises.- Provide a link to other parts of the National Security Secretariat to identify efficiencies for duty arrangements alongside maintaining duty arrangements on behalf of the COBR Unit.- Provide a link to HR Business Partners, ensuring compliance with Cabinet Office HR processes, and leading recruitment logistics.- Play a role in supporting the wider COBR Unit responses to any civil emergencies across a range of thematic areas, working across teams in the Cabinet Office to resource and deliver crisis response service.- Champion and lead an innovative learning & development and wellbeing offer for the Readiness & Response team with a focus on professional development.- Line management of 1 EO.The main deliverables of the post are:- Design and maintain a project plan to develop a crisis cadre of Officials from across Government, designing an on/offboarding process and building the capability to surge in to no-notice crisis response.- Develop and maintain a duty resourcing model, ensuring the COBR Unit is appropriately resourced to respond to no-notice incidents 24/7.- Oversight and implementation of a wellbeing strategy for COBR Unit.- Manage a quality crisis management service for COBR across policy, situation cell, and operations functions in response to civil contingencies risks through effective staff rotas.Responding to emergenciesCOBR Unit on call rota: you will be asked if you wish to join a formal COBR Unit on-call rota for civil emergencies, to monitor emerging risks and form the backbone of initial responses where necessary.Civil emergencies: In addition to your normal day-to-day role, you may be called on to fulfil roles across the COBR Unit response team to assist the Government’s response during a civil emergency. You will be expected to be part of any response structure that supports this evolving situation, often contributing outside your normal area of responsibility. You may be required to occasionally work longer and some unsociable hours for which Cabinet Office overtime policy will apply.Given the nature of this role when a crisis occurs you should expect to work in a central London Office. Outside of crisis working the team adopts a hybrid model but you should expect to be in the London Office at least 40% of your time each week.Person specificationEssential criteria- Experience of working in an ambiguous environment with changing priorities.- Experience of autonomy, taking ownership and driving work streams forward using light-touch project methodologies.- Experience in workforce planning.Desirable criteria- Experience in Crisis Management and/or Resilience.BehavioursWe’ll assess you against these behaviours during the selection process:Changing and ImprovingSeeing the Big PictureCommunicating and InfluencingWorking TogetherBenefitsLearning and development tailored to your role.An environment with flexible working options.A culture encouraging inclusion and diversity.A Civil Service Pension which provides an attractive pension, benefits for dependants and average employer contributions of 27%.A minimum of 25 days of paid annual leave, increasing by one day per year up to a maximum of 30.Things you need to knowSelection process detailsThis vacancy is using Success Profiles (opens in a new window), and will assess your Behaviours, Strengths and Experience.As part of the application process you will be asked to complete a CV and a personal statement. Further details around what this will entail are listed on the application form.Candidates will need to provide a 250 word personal statement outlining their skills and experience.Should a large number of applications be received, an initial sift may be undertaken using the lead behaviour, Changing and Improving. Candidates who pass the initial sift will be progressed straight to interview, where they will be asked Behaviour and Strength based questions.Expected timeline (subject to change)Expected sift date – w/c 20/03/2023Expected interview date/s – w/c 03/04/2023Interview location – Remote/London [TBC]Further informationIf you are experiencing accessibility problems with any attachments on this advert, please contact the email address in the ‘contact point for applicants’ section.If successful and transferring from another Government Department a criminal record check may be carried out.In order to process applications without delay, we will be sending a Criminal Record Check to Disclosure and Barring Service on your behalf.However, we recognise in exceptional circumstances some candidates will want to send their completed forms direct. If you will be doing this, please advise Government Recruitment Service of your intention by emailing [email protected] stating the job reference number in the subject heading. The successful candidate will require a minimum of Security Clearance (SC) to start work, and if not already held, candidates will be invited to obtain DV clearance.SC clearance would normally require 5 years UK residency in the past 5 years. This is not an absolute requirement but supplementary checks may be required where individuals have not lived in the UK for the required period. This may mean that your security clearance (and therefore your appointment) will take longer or, in some cases, not be possible. Please note terms and conditions are attached. Please take time to read the document to determine how these may affect you.New entrants are expected to join on the minimum of the pay band.This role is full time only. Applicants who wish to work an alternative pattern are welcome to apply however your preferred working pattern may not be available and you should discuss this with the vacancy holder before applying.Applicants who are successful at interview will be, as part of pre-employment screening, subject to a check on the Internal Fraud Database (IFD). This check will provide information about employees who have been dismissed for fraud or dishonesty offences. This check also applies to employees who resign or otherwise leave before being dismissed for fraud or dishonesty had their employment continued. Any applicant’s details held on the IFD will be refused employment. A candidate is not eligible to apply for a role within the Civil Service if the application is made within a 5 year period following a dismissal for carrying out internal fraud against government.Any move to Cabinet Office from another employer will mean you can no longer access childcare vouchers. This includes moves between government departments. You may however be eligible for other government schemes, including Tax Free Childcare. Determine your eligibility at: https://www.childcarechoices.gov.uk.A reserve list will be held for a period of 12 months, from which further appointments can be made.Reasonable adjustmentsIf a person with disabilities is put at a substantial disadvantage compared to a non-disabled person, we have a duty to make reasonable changes to our processes.If you need a change to be made so that you can make your application, you should:Contact Government Recruitment Service via [email protected] as soon as possible before the closing date to discuss your needs. Complete the ‘Assistance required’ section in the ‘Additional requirements’ page of your application form to tell us what changes or help you might need further on in the recruitment process. For instance, you may need wheelchair access at interview, or if you’re deaf, a Language Service Professional.Feedback will only be provided if you attend an interview or assessment.SecuritySuccessful candidates must undergo a criminal record check.Successful candidates must meet the security requirements before they can be appointed. The level of security needed is security check (opens in a new window).See our vetting charter (opens in a new window).People working with government assets must complete baseline personnel security standard (opens in new window) checks.Nationality requirementsThis job is broadly open to the following groups:UK nationalsnationals of Commonwealth countries who have the right to work in the UKnationals of the Republic of Irelandnationals from the EU, EEA or Switzerland with settled or pre-settled status or who apply for either status by the deadline of the European Union Settlement Scheme (EUSS) (opens in a new window)relevant EU, EEA, Swiss or Turkish nationals working in the Civil Servicerelevant EU, EEA, Swiss or Turkish nationals who have built up the right to work in the Civil Servicecertain family members of the relevant EU, EEA, Swiss or Turkish nationalsFurther information on nationality requirements (opens in a new window)Working for the Civil ServiceThe Civil Service Code (opens in a new window) sets out the standards of behaviour expected of civil servants.We recruit by merit on the basis of fair and open competition, as outlined in the Civil Service Commission’s recruitment principles (opens in a new window).The Civil Service embraces diversity and promotes equal opportunities. As such, we run a Disability Confident Scheme (DCS) for candidates with disabilities who meet the minimum selection criteria.The Civil Service also offers a Redeployment Interview Scheme to civil servants who are at risk of redundancy, and who meet the minimum requirements for the advertised vacancy.Apply and further informationThis vacancy is part of the Great Place to Work for Veterans (opens in a new window) initiative.The Civil Service welcomes applications from people who have recently left prison or have an unspent conviction. Read more about prison leaver recruitment (opens in new window).Once this job has closed, the job advert will no longer be available. You may want to save a copy for your records.Contact point for applicantsJob contact :Name :Josh WilliamsEmail :[email protected] team :Email :[email protected] informationAppointment to the Civil Service is governed by the Civil Service Commission’s Recruitment Principles. If you feel that your application has not been treated in accordance with the Recruitment Principles, and wish to make a complaint, then in the first instance you should contact Government Recruitment Service by email at : [email protected] you are not satisfied with the response you receive, then you can contact the Civil Service Commission at [email protected]. For further information on the Recruitment Principles. and bringing a complaint to the Civil Service Commission, please visit their website at: https://civilservicecommission.independent.gov.uk.AttachmentsCabinet Office Terms and Conditions – External Opens in new window(pdf, 81kB)Cabinet Office Employee Offer Opens in new window(pdf, 302kB)Share this pagePrintEmailFacebookTwitterLinkedInGMail Support Links. Help Terms and Conditions Privacy Notice Accessibility Statement Cookies Built by Cabinet OfficeOpen Government LicenceAll content is available under the Open Government Licence v3.0, except where otherwise stated © Crown copyright | https://www.civilservicejobs.service.gov.uk/csr/jobs.cgi?jcode=1844885 |
| UK Government, Cabinet Office | Skip to main contentCookies on Civil Service JobsWe use some essential cookies to make this website work.To understand how you use Civil Service Jobs and improve the website we’d like to set some additional cookies.GOV.UK Civil Service JobsBETA Your feedback will help us to improve.Home Sign in / create an account Cymraeg Assistant Private Secretary – Cabinet Office CommunicationsCabinet OfficeApply before 11:55 pm on Tuesday 28th March 2023 DetailsReference number273986Salary£28,050 – £30,771Job gradeExecutive OfficerContract typePermanentBusiness areaCO – Government CommunicationsType of roleAdministration / Corporate SupportCommunications / MarketingSecretarialWorking patternFull-timeNumber of jobs available1ContentsLocationAbout the jobBenefitsThings you need to knowApply and further informationLocationLondonAbout the jobJob summaryOur mission is to deliver exceptional public service communication that makes a difference.People work in government communications because what we do matters. We explain the objectives and policies of the government of the day. We provide clarity and reassurance to the public at times of crisis. We support businesses to grow. We protect our environment. We help those in need to access support.The Government Communication Service (GCS) is the professional body for all public service communicators working in government. Our GCS membership incorporates marketing, stakeholder engagement, internal communications, media, digital and social, and operational communications professionals. We collaborate across government with 25 ministerial departments, 21 non-ministerial departments and more than 300 agencies in addition to other public bodies.It’s an exciting time to be a communications professional in government. The launch of the GCS Strategy 2022-2025 sets our vision to harness the rapid technological changes in communications for the public good; whilst developing our talent with unparalleled opportunities for learning and development. All whilst carrying out interesting, meaningful and purposeful work.Of course, key to the work of our communications professionals is collaborating across boundaries and taking a genuinely diverse and inclusive approach; communicating with and being representative of our audiences in all four corners of the UK. As a communications professional in GCS, you can be at the forefront of driving our ambitions forward.Working for the Executive Director of Government Communication (EDGC)The post holder will support the Executive Director of Government Communications, who isresponsible for National Security communications, the GCS’s international work and the Cabinet Office communications team.Private Office is a small, highly motivated, team whose function is to support the EDGC to ensurethat he is as effective as possible in his role.The Cabinet Office has a vital role at the heart of the UK’s government, responsible for the effective running of government and taking the lead in certain critical policy areas. More information about our work can be found here.Job descriptionThe Assistant Private Secretary will deal with a number of arising issues in the Director’s office, including diary management, and business and operational support.The role requires excellent organisation and communication skills, the ability to build relationships with key internal and external stakeholders and work confidently with officials at all levels.You will have the ability to remain calm when busy, think quickly on your feet, work independently and exercise good judgement.You will be able to deal with senior stakeholders, be assertive when needed, but also have a collaborative approach, and be able to build strong working relationships quickly.Diary and inbox managementResponsibility for effective, accurate and timely management of EDGC’s diary, including ensuring that the diary is fully up to date on an ongoing basis.Develop and maintain a comprehensive folder/management system for the PS inbox, monitoring incoming emails, ensuring that items are correctly marked for that day’s box, submissions are correctly named by teams and supporting the Private Secretary to feed back on box submissions.Support the flow of information between the EDGC, private offices, and internal and external stakeholders, responsible for arranging key meetings, creating agendas, circulating and commissioning papers and any logistical arrangements for high level meetings.Travel.Support EDGC’s visits and engagement programme; including supporting the development of visit plans, booking travel and accommodation for engagements and visits, and producing itineraries and day plans for visits and travel.Business support.Responsible for commissioning work on behalf of the EDGC, including submissions and briefings for Ministers or Permanent Secretary.Provide business operations support for EDGC and Private Office; be responsible for knowledge and information management, take minutes in specific, agreed meetings, support HR and staffing processes and team performance management processes, including by overseeing recording and monitoring methods and commissioning action from teams.Person specificationThe ability to build, maintain and manage strong relationships with internal and external stakeholders.Exceptional interpersonal and management skills with the ability to manage both seniors and peers effectively to support the smooth running of Private Office.The ability to work effectively with senior stakeholders, influencing at all levels, and working collaboratively to resolve challenging issues.The ability to think strategically and creatively, recognising where improvements can be made and implementing them.Strong corporate skills working as part of the leadership team of Cabinet Office communications.Excellent writing and comprehension skills, with the ability to communicate effectively via email and other written channels.Familiarity with google systems and Microsoft office applications.BehavioursWe’ll assess you against these behaviours during the selection process:Making Effective DecisionsManaging a Quality ServiceDelivering at PaceWorking TogetherBenefitsLearning and development tailored to your role.An environment with flexible working options.A culture encouraging inclusion and diversity.A Civil Service Pension which provides an attractive pension, benefits for dependants and average employer contributions of 27%.A minimum of 25 days of paid annual leave, increasing by one day per year up to a maximum of 30.Things you need to knowSelection process detailsThis vacancy is using Success Profiles (opens in a new window), and will assess your Behaviours and Experience.Application processPlease complete the application online submitting a CV, personal statement of no more than 250 words including details of your qualifications and skills and 250 word behavioural statements.Should a large number of applications be received, an initial sift may be undertaken using the lead Behaviour, Making Effective Decisions.Selection process – sift and interviewApplications will be sifted and marked against the behaviours, CV and experience, once candidates have been selected they will be invited to interview where they will be assessed against behaviours, CV and experience.Expected timeline (subject to change)Expected sift date – tbcExpected interview date/s – tbcInterview location – 70 Whitehall Reasonable adjustmentsIf a person with disabilities is put at a substantial disadvantage compared to a non-disabled person, we have a duty to make reasonable changes to our processes.If you need a change to be made so that you can make your application, you should:Contact Government Recruitment Service via [email protected] as soon as possible before the closing date to discuss your needs. Complete the ‘Assistance required’ section in the ‘Additional requirements’ page of your application form to tell us what changes or help you might need further on in the recruitment process. For instance, you may need wheelchair access at interview, or if you’re deaf, a Language Service Professional. Security InformationIf successful and transferring from another Government Department a criminal record check may be carried out.In order to process applications without delay, we will be sending a Criminal Record Check to Disclosure and Barring Service on your behalf. However, we recognise in exceptional circumstances some candidates will want to send their completed forms direct. If you will be doing this, please advise Government Recruitment Service of your intention by emailing [email protected] stating the job reference number in the subject heading.Please note that this role requires SC clearance, which would normally need 3 years’ UK residency in the past 5 years. This is not an absolute requirement, but supplementary checks may be needed where individuals have not lived in the UK for that period. This may mean your security clearance (and therefore your appointment) will take longer or, in some cases, not be possible.Applicants who are successful at interview will be, as part of pre-employment screening, subject to a check on the Internal Fraud Database (IFD). This check will provide information about employees who have been dismissed for fraud or dishonesty offences. This check also applies to employees who resign or otherwise leave before being dismissed for fraud or dishonesty had their employment continued. Any applicant’s details held on the IFD will be refused employment. A candidate is not eligible to apply for a role within the Civil Service if the application is made within a 5 year period following a dismissal for carrying out internal fraud against government.Further informationIf you are experiencing accessibility problems with any attachments on this advert, please contact the email address in the ‘contact point for applicants’ section.New entrants are expected to join on the minimum of the pay band.Please note terms and conditions are attached. Please take time to read the document to determine how these may affect you.Any move to Cabinet Office from another employer will mean you can no longer access childcare vouchers. This includes moves between government departments. You may however be eligible for other government schemes, including Tax Free Childcare. Determine your eligibility at: https://www.childcarechoices.gov.uk.A reserve list will be held for a period of 12 months, from which further appointments can be made.This role is full time only. Applicants who wish to work an alternative pattern are welcome to apply however your preferred working pattern may not be available and you should discuss this with the vacancy holder before applying.Feedback will only be provided if you attend an interview or assessment.SecuritySuccessful candidates must undergo a criminal record check.Successful candidates must meet the security requirements before they can be appointed. The level of security needed is security check (opens in a new window).See our vetting charter (opens in a new window).People working with government assets must complete baseline personnel security standard (opens in new window) checks.Nationality requirementsThis job is broadly open to the following groups:UK nationalsnationals of Commonwealth countries who have the right to work in the UKnationals of the Republic of Irelandnationals from the EU, EEA or Switzerland with settled or pre-settled status or who apply for either status by the deadline of the European Union Settlement Scheme (EUSS) (opens in a new window)relevant EU, EEA, Swiss or Turkish nationals working in the Civil Servicerelevant EU, EEA, Swiss or Turkish nationals who have built up the right to work in the Civil Servicecertain family members of the relevant EU, EEA, Swiss or Turkish nationalsFurther information on nationality requirements (opens in a new window)Working for the Civil ServiceThe Civil Service Code (opens in a new window) sets out the standards of behaviour expected of civil servants.We recruit by merit on the basis of fair and open competition, as outlined in the Civil Service Commission’s recruitment principles (opens in a new window).The Civil Service embraces diversity and promotes equal opportunities. As such, we run a Disability Confident Scheme (DCS) for candidates with disabilities who meet the minimum selection criteria.The Civil Service also offers a Redeployment Interview Scheme to civil servants who are at risk of redundancy, and who meet the minimum requirements for the advertised vacancy.Apply and further informationThis vacancy is part of the Great Place to Work for Veterans (opens in a new window) initiative.The Civil Service welcomes applications from people who have recently left prison or have an unspent conviction. Read more about prison leaver recruitment (opens in new window).Once this job has closed, the job advert will no longer be available. You may want to save a copy for your records.Contact point for applicantsJob contact :Name :[email protected] :[email protected] team :Email :[email protected] informationAppointment to the Civil Service is governed by the Civil Service Commission’s Recruitment Principles. If you feel that your application has not been treated in accordance with the Recruitment Principles, and wish to make a complaint, then in the first instance you should contact Government Recruitment Service by email at : [email protected] you are not satisfied with the response you receive, then you can contact the Civil Service Commission at [email protected]. For further information on the Recruitment Principles. and bringing a complaint to the Civil Service Commission, please visit their website at: https://civilservicecommission.independent.gov.uk.AttachmentsCabinet Office Terms and Conditions – External Opens in new window(pdf, 81kB)Cabinet Office Employee Offer (2) Opens in new window(pdf, 302kB)Share this pagePrintEmailFacebookTwitterLinkedInGMail Support Links. Help Terms and Conditions Privacy Notice Accessibility Statement Cookies Built by Cabinet OfficeOpen Government LicenceAll content is available under the Open Government Licence v3.0, except where otherwise stated © Crown copyright | https://www.civilservicejobs.service.gov.uk/csr/jobs.cgi?jcode=1845007 |
| UK Government, Department for Business, Energy and Industrial Strategy | Skip to main contentCookies on Civil Service JobsWe use some essential cookies to make this website work.To understand how you use Civil Service Jobs and improve the website we’d like to set some additional cookies.GOV.UK Civil Service JobsBETA Your feedback will help us to improve.Home Sign in / create an account Cymraeg Senior Policy Advisor – Greenhouse Gas RemovalsDepartment for Business, Energy & Industrial StrategyApply before 11:55 pm on Tuesday 28th March 2023 DetailsReference number275854Salary£50,305 – £61,145National: £50,305 – £57,760 London: £54,710 – £61,145Job gradeGrade 7Contract typePermanentBusiness areaBEIS – Net Zero Strategy & International – Net Zero Strategy and International (NZSI) – Net Zero StrategyType of roleEnvironment and SustainabilityPolicyWorking patternFlexible working, Full-time, Job share, Part-timeNumber of jobs available1ContentsLocationAbout the jobBenefitsThings you need to knowApply and further informationLocationBirmingham, Cardiff, Darlington, Edinburgh, London, SalfordAbout the jobJob summaryOur MissionAt BEIS, we are leading the UK’s recovery from coronavirus and are building a stronger, greener country. Our varied work makes a real difference to people across the UK and internationally. This is a fantastic opportunity to become part of the BEIS team and our exciting mission!We lead on the UK’s commitments to tackle climate change and drive green economic growth. We support businesses to create jobs and increase opportunity in regions across the UK. We also encourage investment and innovation to make the UK a science superpower producing research that will improve lives.Our Inclusive EnvironmentWe are building an inclusive culture to make BEIS a brilliant place to work where our people feel valued, have a voice and can be their authentic selves. We value difference and diversity, not only because we believe it is the right thing to do, but because it will help us be more innovative and make better decisions.We offer first-class flexible working benefits, excellent employee well-being support and a great pension. We are fortunate to have a range of excellent staff networks and are proud to be a Disability Confident Leader employer. We will support talented people from all backgrounds to build a career and thrive.We actively welcome applications from anyone who shares our commitment to inclusion. We will fully support candidates with a disability or long-term condition who require adjustments in our recruitment process.Job descriptionDo you want to be at the heart of Government’s delivery of net zero by 2050? The Net Zero Frameworks team leads one of the most exciting, important, and wide-ranging policy agendas, developing and coordinating action across Government to deliver our net zero target and legislated ‘carbon budgets’ (interim five-year targets towards 2050).We are seeking to recruit a motivated Grade 7 to lead in a priority policy area in support of our ambitious climate change goals, working closely across government and with a wide range of important stakeholders. The role requires strategic thinking, the ability to grasp a complex policy area and manage risks, together with good stakeholder management and influencing skills.We are a friendly and approachable team and care greatly about fostering an inclusive work culture. We support flexible working arrangements.About the Greenhouse Gas Removals TeamThe team is responsible for the strategy and policy development of a family of technologies called greenhouse gas removals, or GGRs. GGRs is the name given to a group of methods that actively remove greenhouse gases from the atmosphere. There are a range of methods which may be counted as GGRs – from nature-based solutions such as afforestation, to engineered solutions such as Direct Air Carbon Capture and Storage (DACCS), which separates a stream of CO2 from the air that can then be captured and stored. Our team focuses on the latter of these, engineered GGRs.For the UK to reach net zero emissions in 2050, a portfolio of engineered GGRs will be required to balance residual emissions from some of the most difficult to decarbonise sectors, such as industry, agriculture, and aviation. The establishment of standards for these innovative new technologies with a robust monitoring, reporting and verification (MRV) framework is at the heart of our work, and will be crucial to preserve the integrity of any market for negative emissions and to instil public and investor confidence.In this role, you will be at the forefront of this critical work helping to ensure that these technologies are safe, reliable, and effective. You will lead a small team to develop the government’s approach to MRV in order to ensure that GGRs are delivering permanent removals, working closely with our business model policy teams and scientific advisors.The role will span both strategic oversight, and developing and delivering policy proposals for MRV. In particular, you will be responsible for co-ordinating and developing our strategic approach to MRV, filling evidence gaps relating to GGRs MRV, overseeing a review of existing market standards and protocols, and developing HMG’s approach to an independent function to oversee the deployment of GGRs.This is a high priority area for DESNZ, with strong No 10 and HMT interest, and will provide opportunities for you to develop your skills in applying technical research to current policy. It will involve bringing together academic, industry and wider perspectives, including working with international partners, to develop policy, as well as building on the variety of evidence BEIS has commissioned on both Carbon Capture, Usage and Storage (CCUS) and GGRs in recent years. This is a unique opportunity for someone with a passion for climate policy and a desire to make a real impact.Person specificationThe role can be tailored based on the interest and experience of the successful candidate and is expected to include:• Developing the next level of detail on HMG’s GGR MRV requirements, building on the Government response to the GGR Business Model Consultation due later this year.• Drafting of public updates on the design of a GGR MRV Framework and underpinning protocols.• Co-ordinating HMG’s wider work on GGR MRV, including overseeing secretariat for the GGR MRV Working Group.• Leading on building the evidence base to inform policy decisions on MRV, including a review of existing standards and protocols for engineered removals, and their suitability for use in a scheme by HMG.• Developing and maintaining expertise in GGR technologies and best practice in GGR MRV, staying up to date with emerging approaches and technologies.• Overseeing legislative changes and subsequent policy work to enable GGRs to contribute to the UK’s carbon reduction targets.• Building and maintaining relationships, both within government and with external stakeholders.• Drafting high quality advice for senior officials and Ministers, and providing timely input for PQs, FOIs and briefings, as required.Skills and Experience We would love to hear from you if:- You have an interest in developing policy to support the UK’s transition to net zero by 2050- Are a problem solver with the ability to grasp technical or scientific issues- Have excellent communication skills (written and oral), including the ability to present complex issues clearly and concisely to non-specialist audiences- Have experience of planning and managing competing workloads to deliver high-quality work, with and through teams- Have experience of developing proposals or advice for senior management and / or MinistersIt would be helpful, but not essential, to have experience of the following:- An understanding of engineered GGRs- Developing policy with scientific or technical element- Developing regulatory frameworks or bodiesThe Net Zero Strategy Directorate in BEIS is committed to being an inclusive employer with a diverse and representative workforce at all levels. We encourage applications from people from the widest possible diversity of backgrounds, cultures and experiences.We particularly welcome applications from ethnic minority candidates and candidates with other protected characteristics as they are currently underrepresented within some teams. Many people in the directorate have flexible working arrangements, including regular working from home, flexitime, job share and compressed hours. We particularly welcome and will endeavour to support applicants with any additional flexible working approaches.BehavioursWe’ll assess you against these behaviours during the selection process:Making Effective DecisionsWorking TogetherDelivering at PaceBenefitsBEIS offers a competitive mix of benefits including:A culture of flexible working, such as job sharing, homeworking and compressed hours.Automatic enrolment into the Civil Service Pension Scheme, with an average employer contribution of 27%.A minimum of 25 days of paid annual leave, increasing by 1 day per year up to a maximum of 30.An extensive range of learning & professional development opportunities, which all staff are actively encouraged to pursue.Access to a range of retail, travel and lifestyle employee discounts.A hybrid office/home based working model where staff will spend a norm of 40-60% of their time in the office (minimum of 40%) over a month with flex dependent on balancing business and individual need (from September 2021, depending on how the public health guidance evolves).Things you need to knowSelection process detailsThis vacancy is using Success Profiles (opens in a new window), and will assess your Behaviours, Strengths and Experience.As part of the application process you will be asked to complete a CV and personal statement.Further details around what this will entail are listed on the application form.Please use your personal statement (in no more than 500 words) to demonstrate how your skills and experience make you suitable for this role Applications will be sifted on CV and personal statement.In the event of a large number of applicants, applications will be sifted on the personal statement.Candidates who pass the initial sift may be progressed to a full sift, or progressed straight to assessment/interview.The interview will consist of behaviour and strength-based questions.Sift and interview datesExpected Timeline subject to changeSift dates: w/c 03/04/2023Interview dates: 10/04/2023Interview Location: MS Teams.Candidates are asked to note the above timetable, exercising flexibility through the recruitment and selection process.Further InformationExisting BEIS recruitment campaigns are continuing as usual, but candidates should be aware that following the Government’s announcement on the changes to some civil service departments, roles may be subject to the machinery of government moves and will ultimately be located in one of the new departments. We will provide more information if you are selected for a role. . This work remains of high importance to the civil service, and we thank you for your continued interest.Reasonable AdjustmentIf a disabled person is put at a substantial disadvantage compared to a non-disabled person, we have a duty to make reasonable changes to our processes.If you need a change to be made so that you can make your application, you should:Contact Government Recruitment Service via [email protected] as soon as possible before the closing date to discuss your needsComplete the “Assistance required” section in the “Additional requirements” page of your application form to tell us what changes or help you might need further on in the recruitment process. For instance, you may need wheelchair access at interview, or if you’re deaf, a Language Service ProfessionalWe are proud to be a disability confident leader, more information about the Disability Confident Scheme (DCS) and some examples of adjustments that BEIS offers to disabled candidates and candidates with long-term health conditions during our recruitment process can be found in our candidate guidance document. A plain text version of the guidance is also available.If you are experiencing accessibility problems with any attachments on this advert, please contact the email address in the ‘Contact point for applicants’ section.If successful and transferring from another Government Department a criminal record check may be carried out.New entrants are expected to join on the minimum of the pay band.A location based reserve list of successful candidates will be kept for 12 months. Should another role become available within that period you may be offered this position.Please note terms and conditions are attached. Please take time to read the document to determine how these may affect you.Any move to Department for Business, Energy and Industrial Strategy from another employer will mean you can no longer access childcare vouchers. This includes moves between government departments. You may however be eligible for other government schemes, including Tax Free Childcare. Determine your eligibility https://www.childcarechoices.gov.ukBEIS does not normally offer full home working (i.e. working at home); but we do offer a variety of flexible working options (including occasionally working from home). BEIS cannot offer Visa sponsorship to candidates through this campaign. BEIS holds a Visa sponsorship licence but this can only be used for certain roles and this campaign does not qualify.In order to process applications without delay, we will be sending a Criminal Record Check to Disclosure and Barring Service /Disclosure Scotland on your behalf.However, we recognise in exceptional circumstances some candidates will want to send their completed forms direct. If you will be doing this, please advise Government Recruitment Service of your intention by emailing [email protected] stating the job reference number in the subject heading. For further information on the Disclosure Scotland confidential checking service telephone: the Disclosure Scotland Helpline on 0870 609 6006 and ask to speak to the operations manager in confidence, or email [email protected] Applicants who are successful at interview will be, as part of pre-employment screening, subject to a check on the Internal Fraud Database (IFD). This check will provide information about employees who have been dismissed for fraud or dishonesty offences. This check also applies to employees who resign or otherwise leave before being dismissed for fraud or dishonesty had their employment continued. Any applicant’s details held on the IFD will be refused employment. A candidate is not eligible to apply for a role within the Civil Service if the application is made within a 5 year period following a dismissal for carrying out internal fraud against government.FeedbackFeedback will only be provided if you attend an interview or assessment.SecuritySuccessful candidates must undergo a criminal record check.People working with government assets must complete baseline personnel security standard (opens in new window) checks.Nationality requirementsThis job is broadly open to the following groups:UK nationalsnationals of Commonwealth countries who have the right to work in the UKnationals of the Republic of Irelandnationals from the EU, EEA or Switzerland with settled or pre-settled status or who apply for either status by the deadline of the European Union Settlement Scheme (EUSS) (opens in a new window)relevant EU, EEA, Swiss or Turkish nationals working in the Civil Servicerelevant EU, EEA, Swiss or Turkish nationals who have built up the right to work in the Civil Servicecertain family members of the relevant EU, EEA, Swiss or Turkish nationalsFurther information on nationality requirements (opens in a new window)Working for the Civil ServiceThe Civil Service Code (opens in a new window) sets out the standards of behaviour expected of civil servants.We recruit by merit on the basis of fair and open competition, as outlined in the Civil Service Commission’s recruitment principles (opens in a new window).The Civil Service embraces diversity and promotes equal opportunities. As such, we run a Disability Confident Scheme (DCS) for candidates with disabilities who meet the minimum selection criteria.The Civil Service also offers a Redeployment Interview Scheme to civil servants who are at risk of redundancy, and who meet the minimum requirements for the advertised vacancy.Apply and further informationThis vacancy is part of the Great Place to Work for Veterans (opens in a new window) initiative.The Civil Service welcomes applications from people who have recently left prison or have an unspent conviction. Read more about prison leaver recruitment (opens in new window).Once this job has closed, the job advert will no longer be available. You may want to save a copy for your records.Contact point for applicantsJob contact :Name :Flo BarnettEmail :[email protected] team :Email :[email protected] informationAppointment to the Civil Service is governed by the Civil Service Commission’s Recruitment Principles. If you feel that your application has not been treated in accordance with the recruitment principles, and wish to make a complaint, then you should contact in the first instance [email protected]. If you are not satisfied with the response that you receive, then you can contact the Civil Service Commission. For further information on bringing a complaint to the Civil Service Commission please visit their web pages: Click here to visit Civil Service Commission/ComplaintsAttachmentsBEIS TCs Opens in new window(doc, 88kB)Share this pagePrintEmailFacebookTwitterLinkedInGMail Support Links. Help Terms and Conditions Privacy Notice Accessibility Statement Cookies Built by Cabinet OfficeOpen Government LicenceAll content is available under the Open Government Licence v3.0, except where otherwise stated © Crown copyright | https://www.civilservicejobs.service.gov.uk/csr/jobs.cgi?jcode=1844949 |
| Brookings Institution | ABOUT US EXPERTS EVENTS THE BROOKINGS PRESS EXECUTIVE EDUCATION SUPPORT BROOKINGS CAREERS SEARCH CITIES & REGIONS GLOBAL DEVELOPMENT INTERNATIONAL AFFAIRS U.S. ECONOMY U.S. GOVERNMENT MORECAREERSFind us on Facebook Find us on Twitter Find us on YouTube Listen to our Podcast Browse Newsletters Subscribe to our RSSLANGUAGESEspañol中文عربيAbout Us Research Programs Find an Expert For Media Careers ContactTerms and Conditions Brookings Privacy Policy Copyright 2016 The Brookings InstitutionTOPICSABOUT USEXPERTSEVENTSTHE BROOKINGS PRESSEXECUTIVE EDUCATIONSUPPORT BROOKINGSCAREERS | https://careers-brookings.icims.com/jobs/3173/program-assistant-%28job-id%3a-2023-3173%29/job |
| Carnegie Endowment for International Peace | Home JobsPart-time Research Assistant, Global Order and Institutions ProgramJobsLogin 15-Mar-2023 to 27-Mar-2023 (EST) Other Washington, DC, USA Hourly Part TimeEmail Me Similar Jobs Email Me This JobResearch Assistant Global Order and Institutions Program [Global Economic Governance Project] The Carnegie Endowment for International Peace, a global network of policy research centers, is seeking a part-time Research Assistant to support the Global Order and Institutions Program’s Global Economic Governance Project. This position is expected to last until the end of August 2023, and the research assistant will work up to 18 hours per week. The Global Economic Governance project seeks to identify new multilateral rules and frameworks for a more equitable, resilient, and sustainable world economy, at a moment when existing institutions are buffeted by geopolitical upheaval, anti-globalization sentiments, rapid technological change, and transnational threats like climate change and pandemic disease. We will assess possibilities for updating the mandates, governance structures, and operations of major international organizations so that they are fit for purpose in this crisis-prone world. This research agenda will include potential reforms to the main multilateral bodies involved in global development, finance, trade, and related spheres, among them the World Bank, IMF, WTO, and relevant UN agencies. The Research Assistant will conduct background research for Carnegie papers and reports, assist in the drafting (as well as co-author) articles and op-eds, help organize and coordinate events and meetings, engage with government officials, policymakers, experts and civil society interlocutors, and other duties as assigned by the program. Candidates should have a bachelor’s degree in social science or political/international affairs with research experience. An advanced understanding of multilateral institutions and international political economy is required. Applicants must be self-starters with excellent attention to detail, be able to work independently, adapt quickly and possess strong organizational and interpersonal skills. To apply, please submit your resume/C.V., cover letter, and a one-page writing sample via the Carnegie Endowment website. The Carnegie Endowment maintains a strong commitment to diversity. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, national origin, disability, protected veteran status, sexual orientation, gender identity, or any other protected group. Apply Now* Fields Are RequiredWhat is your full name?First NameHow can we contact you?EmailPhone NumberNumber TypeHomeCellWorkWhat is your preferred method of communication?EmailText MessagePlease indicate if you agree to ApplicantPro’s Applicant Communication Policy.Yes, I agree to be contacted by text messagesNo, I do not agree to receive text messages I agree to ApplicantPro’s Applicant Information Use Policy.*Apply for this PositionApply for this PositionSign Up For Job Alerts!Follow Jobs:Share This Page Hiring Software Maintained by ApplicantPro – © 2023 RefreshSearch the FAQ here Go Common Job Questions | https://carnegieendowment.applicantpro.com/jobs/2813632.html |
| The Stimson Center | Home JobsFellow, South Asia ProgramJobsLogin 15-Mar-2023 to 09-Apr-2023 (EST) Washington, DC, USA Full Time Medical, dental, STD/LT disability, life, and ADD insurance. Retirement plan match. Commuting, wellness, and educational benefits.Email Me Similar Jobs Email Me This JobDeadline to Apply: April 9, 2023Fellow, South Asia ProgramThe Henry L. Stimson Center, a nonpartisan policy research center, seeks a dynamic individual to serve as a full-time Fellow for its South Asia Program. The ideal candidate will have substantive expertise on regional security, including military, nuclear, and emerging technology issues. We seek someone with outstanding analytical and writing abilities, strong communication and engagement skills, and experience managing projects, staff, and budgets. The individual should have visited the region frequently and have the ability to work well with key stakeholders in the United States, India and Pakistan.The South Asia program produces research and analysis on strategic trends and geopolitical dynamics in Southern Asia order to inform policy debates and scholarly work. We believe this dispassionate, reasoned approach is vital to generating high-quality strategic thinking that will advance regional and global stability. The program also focuses its efforts on partnering with the next generation of South Asian analysts and policymakers to build better tools for regional stewardship and enduring relationships for deliberative engagement. We seek to foster space for respectful dialogue and debate for all those who seek it, be they rising scholars, contemporary experts, or government officials from New Delhi, Islamabad, Washington DC, and Beijing.The expected start date is May 15, 2023, and the selected candidate will be required to be based in the Washington, DC area. Salary is commensurate with experience and organization-wide compensation levels. Applicants selected for interviews will be required to complete one or more short assessment exercises.DUTIESSupport program leadership, contributing to strategic direction and planning;Oversee projects including the Strategic Learning Initiative, simulations, and track II engagements;Carry out research and analysis on nuclear, strategic, and regional security issues;Supervise, mentor, and ensure professional development of program staff;Manage program budgets, planning, staff, and outreach strategies;Engage in public speaking, media engagements, and other forms of outreach;Plan, convene, and oversee in-person and virtual meetings and events;Build relationships with internal and external stakeholders, including regional contacts;Conduct regular travel to India, Pakistan, and other regional destination for outreach;Identify and cultivate funding sources, and prepare funding proposals; andPerform other tasks as needed.QUALIFICATIONSRequired:Master’s degree or higher in a related field;7-10 years of relevant work experience;Substantive knowledge of South Asian security issues;Superior writing skills and analytical capabilities;Strong project, personnel, and budget management experience;Demonstrated leadership capacity;Ability to work independently and to collaborate with peers in a team environment; andDiplomatic skills and cultural sensitivity.Preferred:Fundraising and project development experience;Prior long-term educational or professional experience in the region;Language skills in Hindi, Urdu, Mandarin, or other regional language(s); andExperience with data science methods and platforms, or with programming languages.APPLICATION REQUIREMENTSPlease submit the following in a single PDF in the order listed below:Cover letter including salary expectations;Resume (maximum two pages);Short writing sample (op-ed style, maximum two pages); andLong writing sample (paper-style, maximum 10 pages).Applicants selected for interviews may be required to complete one or more short research, editing, and/or writing assignments.Stimson is an equal opportunity employer that celebrates, supports, and promotes diversity, equity, and inclusion. We will consider all qualified applicants without regard to race, color, religion, sex, national origin, disability, protected veteran status, sexual orientation or gender identity, or any other legally protected basis, in accordance with applicable laws.Apply Now* Fields Are RequiredWhat is your full name?First NameHow can we contact you?EmailPhone NumberNumber TypeHomeCellWorkWhat is your preferred method of communication?EmailText MessagePlease indicate if you agree to ApplicantPro’s Applicant Communication Policy.Yes, I agree to be contacted by text messagesNo, I do not agree to receive text messages I agree to ApplicantPro’s Applicant Information Use Policy.*Apply for this PositionApply for this PositionSign Up For Job Alerts!Follow Jobs:Share This Page NonProfit Hiring Software from ApplicantPro – © 2023 RefreshSearch the FAQ here Go Common Job Questions | https://stimson.applicantpro.com/jobs/2812482.html |
| US Government, Government Accountability Office | An official website of the United States government Sign in Help SearchOperations Research Analyst (Schedule Estimating)LEGISLATIVE BRANCHGovernment Accountability OfficeScience, Technology Assessment and AnalyticsSummary This job is open to Duties Requirements How you will be evaluated Required documents How to ApplySummaryThis position is located in GAO’s Science, Technology Assessment, & Analytics (STAA) Team. The STAA is devoted to enhancing & expanding its support to Congress in conducting technology assessments, oversight of federal science and technology programs, & development of innovative analytical techniques in carrying out audits and evaluations. To learn more visit: STAALearn more about this agency HelpThis job is open toThe publicU.S. Citizens, Nationals or those who owe allegiance to the U.S.Clarification from the agencyThis position may be filled in any of the locations listed. Pay will be set consistent with the salary range for the location the position is filled in. DC – $105,306 – $147,726 Huntsville – $95,676 – $134,272 Oakland – $116,654 – $164,253 Denver – $104,815 – $147,036 Atlanta – $98,129 – $137,898 Boston – $110,625 – $155,800 Dallas – $104,373 – $146.414 Seattle – $105,545 – $148,062 HelpThis job is also open in another announcement to:Federal employees – Competitive serviceIndividuals with disabilitiesSpecial authoritiesVeteransVideos HelpDutiesThe STAA team is seeking an experienced professional to serve as a Sr. Operations Research Analyst (Schedule Estimating) providing technical advice, analyses and support services to GAO engagement teams in the areas of schedule and schedule risk analysis, cost estimation, and earned value management. Specifically, the incumbent:Supports the conduct of schedule estimating, schedule risk analysis, earned value management (EVM), and cost estimation of large systems and acquisitions in the federal government, including but not limited to major weapons systems, IT modernization, aircraft, and satellite systems.Performs assessments of a program’s schedule data, EVM, and cost estimate to determine to what extent each is meeting best practices called for in GAO’s Schedule Assessment Guide and Cost Estimating and Assessment Guide.Analyzes and reviews major acquisition integrated master schedules, conducts independent schedule risk and uncertainty analyses, and analyzes contract performance metrics. Interviews agency officials to discuss audit findings related to best practices.Prepares written assessments of schedule, schedule risk, EVM, and cost analyses that contain sufficient support and rationale for conclusions. Works with experts outside GAO to determine best practices for scheduling, EVM, and cost estimating as necessary. Provides related oral presentations to both internal GAO customers and external customers such as Congressional staff.Reviews products for adequate coverage and supportable conclusions regarding sound scheduling, earned value management, and cost estimating.Provides expert advice, guidance and support to engagement teams across GAO on all advanced technical analyses in related areas. Identifies key deficiencies in schedule issues and analyzes and interprets earned value management data including evaluation of formats I through VII.Effectively advises teams on best technical approaches to achieve quality results. Provides training to staff as required on schedule estimation and earned value management analysis.Performs other duties as assigned. HelpRequirementsConditions of EmploymentMust be a U.S. Citizen.You will be required to submit a financial disclosure statement.Must be able to meet/maintain suitability & security requirements. You may be required to obtain and maintain a security clearance depending on the engagements, projects, and initiatives you are assigned to.Completion of a probationary period is required.Selective Service registration, if applicable.QualificationsIn addition to the education requirement, you must have 1 year (52 weeks) of specialized experience equivalent to the next lower band or level equivalent to the GS-12 in the Federal Service, or comparable private/public sector experience which has equipped you with the skills and knowledge to successfully perform the duties of the position. Specialized experience for this position is defined as:- knowledge of and experience in the use of schedule, schedule risk, and EVM software such as Primavera P6, Microsoft Project, Cobra, Crystal Ball, and the like;- independently conducting risk and uncertainty analysis for schedules for major acquisitions and large scale commodities, including methodologies such as risk drivers and joint cost and schedule risk analysis; and- developing, analyzing, and evaluating resource-loaded integrated master schedules, including those used as performance measurement baselines with earned value management systems.Experience refers to paid and unpaid experience, including volunteer work done through National Service programs (e.g., Peace Corps, AmeriCorps) and other organizations (e.g., professional; philanthropic; religious; spiritual; community, student, social). Volunteer work helps build critical competencies, knowledge, and skills and can provide valuable training and experience that translates directly to paid employment. You will receive credit for all qualifying experience, including volunteer experience.You must meet all the requirements before the closing date of the announcement.EducationThis position has a positive education requirement. Documentation to verify your education MUST be submitted with your application in order to be considered.Basic Requirements:Degree: in operations research.ORAt least 24 semester hours in a combination of operations research, mathematics, probability, statistics, mathematical logic, science, or subject-matter courses requiring substantial competence in college-level mathematics or statistics. At least 3 of the 24 semester hours must have been in calculus.Additional informationThis is a bargaining unit position.Based on the staffing needs, additional selections may be made through this vacancy announcement.You will be required to file a Financial Disclosure Statement.Travel and relocation expenses will not be paid for by the GAO.You will be required to complete questions contained on the Declaration for Federal Employment (OF-306) at the time a tentative job offer is made. At the time of appointment, you will be required to update the OF-306.You will be subject to a determination of suitability for Federal employment.GAO provides reasonable accommodations to applicants and employees with disabilities. To request accommodation, please email [email protected]’s policy is to provide equal employment opportunity for all regardless of race, religion, color, sex (including pregnancy), national origin, age, disability, genetic information, sexual orientation, or gender identity.GAO is part of the Legislative Branch of the Federal government. As such, all positions are in the excepted service. Initial appointments, permanent or indefinite, to the GAO require completion of a probationary period.Read moreBenefitsHow You Will Be EvaluatedYou will be evaluated for this job based on how well you meet the qualifications above.If you meet the qualification requirements stated, you will be further rated based on your responses to the assessment questions and placed in one of three categories: Best Qualified, Well Qualified, or Qualified. The Category Rating Process does not add veterans’ preference points but protects the rights of Veterans by placing them ahead of non-preference eligibles within each quality category. Veterans’ preference eligibles who meet the minimum qualification requirements and who have a compensable service- connected disability of at least 10 percent will be listed in the highest quality category (except in the case of scientific or professional positions at the GS-09 level or higher).Please follow all instructions carefully. If you provide incomplete answers, fail to provide a narrative response to any vacancy question(s) that requires further explanation, or if your response to a vacancy question is “see resume” or like answer, your rating may be affected or you may be determined ineligible.To preview the assessment questionnaire, click https://apply.usastaffing.gov/ViewQuestionnaire/11874164 HelpRequired DocumentsTo apply for this position, you must submit a complete Application Package which includes:RESUME: You are encouraged to use the USAJOBS resume builder to create your resume. In describing your experience, please be clear and specific. In addition to describing duties performed, you must provide the exact dates of each period of employment (from MM/YY to MM/YY) and the number of hours worked per week. We will not make assumptions regarding your experience. Failure to provide this information may result in disqualification. CV’s are not recommended.SF-50: Current and former federal employees eligible for reinstatement should submit a copy of your most recent Notification of Personnel Action (SF-50) that indicates your position information (i.e. title, series, grade).TRANSCRIPTS: If you are using your education to qualify (even partially), you must submit a copy of your transcripts. Foreign Education: If you are submitting a transcript from a non-US educational institution, applicants must submit all necessary documents to a private U.S. organization that specializes in interpretation of foreign educational credentials, commonly called a credential evaluation service. For additional information, please visit: Foreign EducationVETERANS: VEOA and 30% Disabled Veterans must submit adequate proof of active service in the Armed Forces including Member 4 copy of your DD-214, which indicates character of service. To claim 10-point veterans’ preference, you must also submit an SF-15 and a letter from the Department of Veterans Affairs verifying the percentage of your disability and preference in hiring. To claim 5-Point veterans’ preference, you must submit a Member 4 copy of the DD – 214 or if you are currently active duty: an official statement of service from your command.If you fail to submit any of the documentation listed above your application will be considered incomplete, and will result in loss of consideration.If you are relying on your education to meet qualification requirements:Education must be accredited by an accrediting institution recognized by the U.S. Department of Education in order for it to be credited towards qualifications. Therefore, provide only the attendance and/or degrees from schools accredited by accrediting institutions recognized by the U.S. Department of Education.Failure to provide all of the required information as stated in this vacancy announcement may result in an ineligible rating or may affect the overall rating. HelpHow to ApplyTo apply for this position, you must complete the online application and submit the documentation specified in the Required Documents section below. A complete application package must be submitted by 11:59 PM (EST) on the closing date of the announcement to receive consideration.To begin, click Apply to access the online application. You will need to be logged into your USAJOBS account to apply. If you do not have a USAJOBS account, you will need to create one before beginning the application.Follow the prompts to select your résumé (you are encouraged to create a resume using the USAJOBS resume builder) and/or other supporting documentsto be included with your application package. You will have the opportunity to upload additional documents to include in your application before it is submitted. Your uploaded documents may take several hours to clear the virus scan process.After acknowledging you have reviewed your application package, complete the Include Personal Information section as you deem appropriate and click to continue with the application process.You will be taken to the online application which you must complete in order to apply for the position. Complete the online application, verify the required documentation is included with your application package, and submit the application.To verify the status of your application, log into your USAJOBS account (https://my.usajobs.gov/Account/Login), all of your applications will appear on the Welcome screen. The Application Status will appear along with the date your application was last updated. For information on what each Application Status means, visit: https://www.usajobs.gov/Help/how-to/application/status/.Read moreAgency contact information Ebonye [email protected] Accountability OfficeHuman Capital Office441 G Street NWWashington, DC 20548USLearn more about this agencyNext stepsAfter the closing date of this announcement, GAO’s Human Capital Office will conduct an evaluation of your qualifications by reviewing your assessment questionnaire and resume to complete an analysis. Please be as complete and thorough as possible. If your application is rated “best-qualified,” your name will be referred to the selecting official for consideration. At this point you may be contacted for an interview. The Human Capital Office does not manage the interview process and will update your status only after a selection is made.If you do not meet the key requirements and/or basic qualifications, or you fail to submit all required application materials, your application will not be considered.Read moreFair & TransparentThe Federal hiring process is set up to be fair and transparent. Please read the following guidance.Equal Employment Opportunity (EEO) PolicyReasonable accommodation policyFinancial suitabilitySelective ServiceNew employee probationary periodSignature and false statementsPrivacy ActSocial security number requestApply Print ShareSave HelpOverviewAccepting applicationsOpen & closing dates 03/16/2023 to 03/30/2023Salary$95,676 – $164,253 per yearPay scale & gradePE 21Locations1 vacancy in the following locations:Huntsville, ALOakland, CADenver, COWashingtonShow more locations (4)Remote jobNoTelework eligibleYes—as determined by the agency policy.Travel RequiredOccasional travel – You may be expected to travel for this position.Relocation expenses reimbursedNoAppointment typePermanent -Work scheduleFull-time -ServiceExceptedPromotion potentialNoneJob family (Series)1515 Operations ResearchSupervisory statusNoSecurity clearanceOtherDrug testNoAnnouncement numberSTAA-23-DE-11874164Control number712716800Return to topAccountHomeProfileDocumentsSaved jobsSaved searchesHelpHelp centerAbout USAJOBSFAQsContact usGet startedHow to…Working in governmentUSAJOBS is a Opens in a new windowUnited States Office of Personnel Management website.Opens in a new window Opens in a new window Opens in a new window Opens in a new windowOpens in a new windowEEO Policy Statement Opens in a new windowReasonable Accommodation Policy Statement Opens in a new windowVeterans Information Opens in a new windowLegal and Regulatory GuidanceOpens in a new windowTerms and Conditions Opens in a new windowBudget and Performance Opens in a new windowFOIA Opens in a new windowInspector General Opens in a new windowNo Fear Act Data Opens in a new windowPrivacy Policy Opens in a new windowUSA.gov | https://www.usajobs.gov/job/712716800 |
| Alignment Research Center | Operations Manager / GeneralistBERKELEY /EVALS – OPERATIONS /EMPLOYEE/ ON-SITE APPLY FOR THIS JOBIntroductionThe evaluations project at the Alignment Research Center is a new team building capability evaluations (and in the future, alignment evaluations) for advanced ML models. The goals of the project are to improve our understanding of what alignment danger is going to look like, understand how far away we are from dangerous AI, and create metrics that labs can make commitments around (e.g. ‘If you hit capability threshold X, don’t train a larger model until you’ve hit alignment threshold Y’). You can learn more about the project at this linked post on the Alignment Forum.BackgroundThe evaluations project is seeking an operations manager to support its work, reporting to its operations lead. We think that this role offers an exciting opportunity to contribute to AI alignment efforts in an impactful way. We are most likely only looking for people with at least 4 years of professional experience for this position.Team status and styleThe team is pretty new and operates much like a start-up: there is a relatively flat hierarchy and operations needs change frequently. It can therefore be difficult for us to precisely scope the long-term functions of a specific role. The team has made significant progress, but it is also still evaluating questions of “product-market fit”, focus, and orientation toward a number of significant questions that will affect the team size and structure. This position offers a chance to help contribute and influence the team’s development and growth.Job missionYour overall mission is to build, run and maintain systems that help the team get their work done efficiently and effectively. You will be responsible for managing everyday operational projects such as managing key aspects of our recruitment, working on sponsoring a visa, and helping to maintain a budget. Though at times you will be expected to handle tasks such as scheduling, we expect that you’ll often have ownership of projects critical to our work. You’ll report and work most closely with the evaluations project’s operations lead.Key Competencies- Highly organized. As a key member of our team, you will be expected to work on a diverse set of tasks and relationships. The demands of this role will require a flexible and adaptable approach, as you may be required to prioritize either quality or speed depending on the situation. The ability to adjust your work style accordingly is vital to succeeding in this position.- Executive function. To excel in this role you will need strong managerial skills and the ability to think strategically in order to guide and support a growing team. We expect to give you large areas of responsibility with low supervision; you will be responsible for making informed and insightful decisions that align with the overall goals of the project. This will require the ability to analyze and understand both short and long-term plans, as well as anticipate and plan for potential challenges. Insight and adaptability in response to changing circumstances are key.- Eagerness to learn. We hope to make ARC Evals a place that builds top operational talent. We’re excited about finding people who want to become excellent at this work, and giving them sufficient direction, access to resources, and ownership such that they experience rapid growth. The ability to take, reflect on, and especially implement frequent feedback, as well as the confidence to challenge existing beliefs (of your own and your manager’s), is an asset to this position.- Drive. The optimal candidate will have a strong drive to contribute and make a positive impact on the team. As a key member of the team, you will be expected to take initiative and be proactive in your efforts to support and improve the team’s performance. You should be comfortable working independently and taking on new challenges, but also be a team player who is willing to collaborate and support your colleagues. A strong drive to contribute and make a difference is important in this role.- Interpersonal skills. This role requires strong communication skills and the ability to interact with others in an empathetic and professional manner. You will be a point of contact for potential hires, contractors, and staff. A strong candidate would help to facilitate high quality communication and organizational health across the team.- Research interest. You’ll sometimes need to thoroughly investigate novel topics and provide solutions that can be relied upon by the organization and team. While most tasks will require a balanced approach of efficiency and effectiveness, the ability to investigate new topics in depth and apply newfound expertise to your work is valuable in this position.While technical expertise is not necessary for this position, a strong interest in AI and AI safety is essential.Other infoLocationWe’re based out of Constellation offices in Downtown Berkeley. There’s an onsite chef who provides lunch and dinner daily, there’s exercise equipment, showers, snacks, and a great community!For technical roles, we fairly strongly prefer someone who can be in-person, but WFH some days of the week is fine, and remote is not a complete dealbreaker.For operations roles, we expect to only consider candidates who can relocate and work in-person.We should be able to sponsor visas for technical roles for those who need them (and as ARC is a non-profit, we don’t have to go through the visa lottery for H1-B). There is a small chance we can sponsor for non-technical roles as well; we expect to only consider pursuing this for exceptional candidates.Pay & BenefitsCompensation is competitive with Bay Area tech roles (excluding equity, and we provide unlimited PTO to all employees.ARC’s additional benefits include premium health insurance with more than 90% of premiums covered, a generous mental health allowance, and long-term disability insurance. We are working to expand upon this throughout the year, and we will especially prioritize putting in place those benefits most requested by our existing or incoming staff.Application processWe primarily use work tests for our evaluations. If we proceed with your application after review, we’ll typically ask you to do 1 to 3 of these (in addition to 1-2 interviews).For some roles the first of these is expected to take less than 45 minutes, for others, it may take up to three hours. If we ask you to do a work test that is expected to take more than 1 hour (typical interview length), we will compensate you at a competitive hourly rate for your time.After the first 1-2 work tests, we’ll schedule an interview to discuss the ideas behind the project, what you’re looking for in a role, ask you any questions we have, and provide time for any other questions you have.After that we’d optimally do a 1-3 month trial period; we’re open to figuring out how to manage this with each candidate.Further infoOur applications have no strict deadlines, but we evaluate candidates as they apply. Therefore it may be to your advantage to submit an application sooner rather than later.We encourage you to apply even if your background may not seem like the perfect fit! We would rather review a larger pool of applications than risk missing out on a promising candidate for the position.We will not necessarily fill all open roles, and we may have candidates already trialing for some roles listed. We are also open to customizing or reconfiguring roles to meet the talent profile of candidates; please just apply to the closest match.We are committed to diversity and equal opportunity in all aspects of our hiring process. We do not discriminate on the basis of race, religion, national origin, gender, sexual orientation, age, marital status, veteran status, or disability status. We welcome and encourage all qualified candidates to apply for our open positions.APPLY FOR THIS JOBAlignment Research Center – Evaluations Project Home PageJobs powered by | https://jobs.lever.co/alignment.org/10ca772d-696b-408f-ae6e-ee81a75b5cfb |
| Anthropic | Research EngineerSAN FRANCISCO, CA /RESEARCH /FULL-TIME/ HYBRID APPLY FOR THIS JOBYou want to build large scale ML systems from the ground up. You care about making safe, steerable, trustworthy systems. As a Research Engineer, you’ll touch all parts of our code and infrastructure, whether that’s making the cluster more reliable for our big jobs, improving throughput and efficiency, running and designing scientific experiments, or improving our dev tooling. You’re excited to write code when you understand the research context and more broadly why it’s important.You might be a good fit if youHave significant software engineering experienceAre results-oriented, with a bias towards flexibility and impactPick up slack, even if it goes outside your job descriptionEnjoy pair programming (we love to pair!)Want to learn more about machine learning researchCare about the societal impacts of your workStrong candidates may also have experience with some of the followingHigh performance, large-scale ML systemsGPUs, kubernetes, pytorch, OS internalsLanguage modeling with transformersReinforcement learningLarge-scale ETLRepresentative projectsOptimizing the throughput of a new attention mechanismComparing the compute efficiency of two Transformer variantsMaking a Wikipedia dataset in a format models can easily consumeScaling a distributed training job to thousands of GPUsWriting a design doc for fault tolerance strategiesCreating an interactive visualization of attention between tokens in a language modelHow we’re differentWe believe that the highest-impact AI research will be big science. At Anthropic we work as a single cohesive team on just a few large-scale research efforts. And we value impact — advancing our long-term goals of steerable, trustworthy AI — rather than work on smaller and more specific puzzles.We view AI research as an empirical science, which has as much in common with physics and biology as with traditional efforts in computer science. We’re most excited to hire researchers from diverse backgrounds who share this perspective.We’re an extremely collaborative group, and we host frequent research discussions to ensure that we are pursuing the highest-impact work at any given time. As such, we greatly value communication skills.We’re trying to build a core of knowledge and intuition about the most robustly effective innovations in AI, and so thoroughly-documented null results are almost as valuable as positive discoveries.We do not have boundaries between engineering and research, and we expect all of our technical staff to contribute to both as needed.$250,000 – $445,000 a yearSalary – The expected salary range for this position is $250k – $445k.Hybrid policy: For this role, we prefer candidates who are able to be in our office more than 25% of the time, though we encourage you to apply even if you don’t think you will be able to do that.—LinkedIn tracking: #LI-DNICompensation and Benefits*Anthropic’s compensation package consists of three elements: salary, equity, and benefits. We are committed to pay fairness and aim for these three elements collectively to be highly competitive with market rates.Equity – On top of this position’s salary (listed above), equity will be a major component of the total compensation. We aim to offer higher-than-average equity compensation for a company of our size, and communicate equity amounts at the time of offer issuance.Benefits – Benefits we offer include:- Optional equity donation matching at a 3:1 ratio, up to 50% of your equity grant.- Comprehensive health, dental, and vision insurance for you and all your dependents.- 401(k) plan with 4% matching.- 21 weeks of paid parental leave.- Unlimited PTO – most staff take between 4-6 weeks each year, sometimes more!- Stipends for education, home office improvements, commuting, and wellness.- Fertility benefits via Carrot.- Daily lunches and snacks in our office.- Relocation support for those moving to the Bay Area.* This compensation and benefits information is based on Anthropic’s good faith estimate for this position, in San Francisco, CA, as of the date of publication and may be modified in the future. The level of pay within the range will depend on a variety of job-related factors, including where you place on our internal performance ladders, which is based on factors including past work experience, relevant education, and performance on our interviews or in a work trial.How we’re differentWe believe that the highest-impact AI research will be big science. At Anthropic we work as a single cohesive team on just a few large-scale research efforts. And we value impact — advancing our long-term goals of steerable, trustworthy AI — rather than work on smaller and more specific puzzles. We view AI research as an empirical science, which has as much in common with physics and biology as with traditional efforts in computer science. We’re an extremely collaborative group, and we host frequent research discussions to ensure that we are pursuing the highest-impact work at any given time. As such, we greatly value communication skills. The easiest way to understand our research directions is to read our recent research. This research continues many of the directions our team worked on prior to Anthropic, including: GPT-3, Circuit-Based Interpretability, Mulitmodal Neurons, Scaling Laws, AI & Compute, Concrete Problems in AI Safety, and Learning from Human Preferences.—Hybrid policy: Currently, we expect all staff to be in our office at least 25% of the time.Deadline to apply: None. Applications will be reviewed on a rolling basis.We encourage you to apply even if you do not believe you meet every single qualification. Not all strong candidates will meet every single qualification as listed. Research shows that people who identify as being from underrepresented groups are more prone to experiencing imposter syndrome and doubting the strength of their candidacy, so we urge you not to exclude yourself prematurely and to submit an application if you’re interested in this work. We think AI systems like the ones we’re building have enormous social and ethical implications. We think this makes representation even more important, and we strive to include a range of diverse perspectives on our team.Come work with us! Anthropic is a public benefit corporation based in San Francisco. We offer competitive compensation and benefits, optional equity donation matching, generous vacation and parental leave, flexible working hours, and a lovely office space in which to collaborate with colleagues.APPLY FOR THIS JOBJobs powered by | https://jobs.lever.co/Anthropic/436ca148-6440-460f-b2a2-3334d9b142a5 |
| Alignment Research Center | Generalist Software Engineer, Web Dev and ML focusBERKELEY /EVALS – ENGINEERING & RESEARCH /EMPLOYEE/ ON-SITE APPLY FOR THIS JOBIntroductionThe evaluations project at the Alignment Research Center is a new team building capability evaluations (and in the future, alignment evaluations) for advanced ML models. The goals of the project are to improve our understanding of what alignment danger is going to look like, understand how far away we are from dangerous AI, and create metrics that labs can make commitments around (e.g. ‘If you hit capability threshold X, don’t train a larger model until you’ve hit alignment threshold Y’). You can learn more about the project at this linked post on the Alignment Forum.BackgroundWe’ve built an interface for interacting with models and assessing their abilities at various tasks, having contractors write demo actions and rate model-generated actions. The basic idea:- do tasks as a sequence of steps, where at each step we have the model generate a number of options for the next action, then have either the model or the humans choose which action to go with- let models do tasks in a factored-cognition style – delegating sub-tasks to other copies of the model – then be able to view the tree of tasks and see where models struggle and where they do well- have contractors add their own options, and rate the quality of generated options- tag steps with what abilities or difficulties they highlight Screenshots:1. http://res.cloudinary.com/lesswrong-2-0/image/upload/v1669820148/mirroredImages/svhQMdsefdYFDq5YM/zmwsyetcis9ra5pcqpc8.png2. http://res.cloudinary.com/lesswrong-2-0/image/upload/v1669820148/mirroredImages/svhQMdsefdYFDq5YM/gxe7xiyr22tth9moocbr.pngJob Mission:Improve the interface for interacting with models so we can generate data, evaluate model properties and understand our existing data better + faster. Key Outcomes:- Design and build new ways to interact with models and with our existing data so far- Unlock discoveries by things like:- Improve user experience and therefore speed and accuracy of data generation- Automating the process of prompting the model, running model’s commands, formatting task and delegating to different model, etc – allowing us to discover properties of the model we only see after getting a long way into some task- Build tools to visualize and interact with data that lets us spot and understand patterns in the model’s strengths and weaknesses- Improve model performance on our tasks by improving the ‘scaffolding’ we’re using to help LMs accomplish the tasks (e.g. automatically ask the model whether it’s stuck, if so restart)- Make our data pipeline clean and beautiful, assess data quality from our contractors, catch bugs and problems, and produce useful datasets for the alignment community.- Stick with the project and make yourself useful on whatever needs doing if we realize we need to throw lots of our work away and do something differentSomeday/maybe outcomes:- Help us develop ideas and build tools for evaluating harder-to-define model properties related to alignment, agency and deception Key Competencies: Essential- Strong coding ability. Able to rapidly prototype features and write clear, easy-to-extend code. We’re currently using React, Typescript, Python, SQL, Flask. – Good communication skills: Always asks for clarification if priorities are ambiguous. Good at pairing and teaching others how your code works.- Learning, ownership, and ‘scrappiness’: Quick to pick up whatever skills and knowledge are required to make the project succeed. Keeps the overall aims of the project in mind. Not afraid to point out if something should be done differently, even if it’s not part of their core responsibility.Nice-to-have- Design + data-viz skills: Generates novel ideas for improving usability and providing an interaction experience that unlocks insights about the data or the model- ML skills: Able to do things like tune hyperparameters for a finetuning run, investigate scaling laws for a particular property of interest, or suggest techniques we could use to improve model performance on our dataset.- Basic ML knowledge: Good understanding of how LLMs ‘think’, and what sorts of things will affect performance.- Conceptual alignment thinking: help generate and evaluate ideas for how to probe alignment, deception, agency and other conceptually slippery properties.FitReasons this might be a bad fit for you- There’s some uncertainty about whether we’re on the right track, and we expect to pivot sometimes. If that sounds stressful or demotivating, this might not be a good fit.- You want an experienced/senior manager – Beth has limited managing experience- You want to work within an established process that’s set by someone else. We don’t have detailed processes or philosophies of development/product/project management – You want to work on challenging algorithmic problems or gritty GPU kernels. Most of the coding you’ll be doing is likely to be pretty straightforward in some sense, we’ll likely only be interacting with models via APIs. Reasons this might be an especially good fit- You’re excited about working on a relatively new team/project, growing together, and helping shape it into something really awesome- Interacting a lot with cutting-edge models sounds interesting and fun- You find it motivating for your work to have a pretty clear and direct story for how it’s relevant to x-risk. Other infoLocationWe’re based out of Constellation offices in Downtown Berkeley. There’s an onsite chef who provides lunch and dinner daily, there’s exercise equipment, showers, snacks, and a great community!For technical roles, we fairly strongly prefer someone who can be in-person, but WFH some days of the week is fine, and remote is not a complete dealbreaker.For operations roles, we expect to only consider candidates who can relocate and work in-person.We should be able to sponsor visas for technical roles for those who need them (and as ARC is a non-profit, we don’t have to go through the visa lottery for H1-B). There is a small chance we can sponsor for non-technical roles as well; we expect to only consider pursuing this for exceptional candidates.Pay & BenefitsCompensation is competitive with Bay Area tech roles (excluding equity, and we provide unlimited PTO to all employees.ARC’s additional benefits include premium health insurance with more than 90% of premiums covered, a generous mental health allowance, and long-term disability insurance. We are working to expand upon this throughout the year, and we will especially prioritize putting in place those benefits most requested by our existing or incoming staff.Application processWe primarily use work tests for our evaluations. If we proceed with your application after review, we’ll typically ask you to do 1 to 3 of these (in addition to 1-2 interviews).For some roles the first of these is expected to take less than 45 minutes, for others, it may take up to three hours. If we ask you to do a work test that is expected to take more than 1 hour (typical interview length), we will compensate you at a competitive hourly rate for your time.After the first 1-2 work tests, we’ll schedule an interview to discuss the ideas behind the project, what you’re looking for in a role, ask you any questions we have, and provide time for any other questions you have.After that we’d optimally do a 1-3 month trial period; we’re open to figuring out how to manage this with each candidate.Further infoOur applications have no strict deadlines, but we evaluate candidates as they apply. Therefore it may be to your advantage to submit an application sooner rather than later.We encourage you to apply even if your background may not seem like the perfect fit! We would rather review a larger pool of applications than risk missing out on a promising candidate for the position.We will not necessarily fill all open roles, and we may have candidates already trialing for some roles listed. We are also open to customizing or reconfiguring roles to meet the talent profile of candidates; please just apply to the closest match.We are committed to diversity and equal opportunity in all aspects of our hiring process. We do not discriminate on the basis of race, religion, national origin, gender, sexual orientation, age, marital status, veteran status, or disability status. We welcome and encourage all qualified candidates to apply for our open positions.APPLY FOR THIS JOBAlignment Research Center – Evaluations Project Home PageJobs powered by | https://jobs.lever.co/alignment.org/d12bfa4a-6958-43f2-aff7-56f6a9651db4 |
| Lawrence Livermore National Laboratory | Skip to main contentPrimary MenuMissionsScience & TechnologyProgramsDoing BusinessNewsAboutJoin Our TeamCommunitySearchAre you a current employee?Search internal jobsHomeFind Your JobCareer AreasStudentsPostdocsEvents & Resources Back to open positionsNet Assessment Systems Analysts – Entry Level Entry Level | Full-time Security | livermore, CA | 03/15/2023Reference #: REF3762IJob Code: SES.1 Science & Engineering MTS 1 / SES.2 Science & Engineering MTS 2Organization: Office of the Director Career IndefiniteSecurity Clearance: Anticipated DOE Q clearance with Sensitive Compartmented Information access (requires U.S. citizenship and a federal background investigation)Drug Test: Required for external applicant(s) selected for this position (includes testing for use of marijuana)Medical Exam: Not applicableApply Now Share this jobRefer a friend Submit a referral Get more jobsCompany DescriptionJoin us and make YOUR mark on the World!Are you interested in joining some of the brightest talent in the world to strengthen the United States’ security? Come join Lawrence Livermore National Laboratory (LLNL) where our employees apply their expertise to create solutions for BIG ideas that make our world a better place.We are committed to a diverse and equitable workforce with an inclusive culture that values and celebrates the diversity of our people, talents, ideas, experiences, and perspectives. This is essential to innovation and creativity for continued success of the Laboratory’s mission.Pay Range$103,290.00 – $139,128.00 Annually for the SES.1 level$123,960.00 – $166,992.00 Annually for the SES.2 levelPlease note that the pay range information is a general guideline only. Many factors are taken into consideration when setting starting pay including education, experience, the external labor market, and internal equity.Job DescriptionWe are seeking entry level Net Assessment Systems Analysts with backgrounds in physical and life sciences, information sciences, engineering, operations research, science and technology policy analysis, or decision analytics to provide technical analysis in support of strategic studies conducted on behalf of the National Nuclear Security Administration (NNSA) and other U.S. Government partners. These studies will inform net assessments of capabilities and strategy in the context of geopolitical competition.As a net assessment systems analyst, you will work with experienced net system analysts and contribute to the analysis to provide insights to inform long-term strategy and planning for the NNSA.This position will be filled at either level based on knowledge and related experience as assessed by the hiring team. Additional job responsibilities (outlined below) will be assigned if hired at the higher level.In this role you will:Participate in the analysis relating to a variety of national security challenges relevant to the NNSA’s nuclear security mission, specifically nuclear weapons science, infrastructure, production, nonproliferation, and counterproliferation.Contribute to cross-functional and multi-disciplinary teams to solve technical problems.Provide solutions to problems of limited complexity for modeling and simulation or other technical analyses.Contribute to the development of analytical frameworks that provide insight to customers on challenges.Participate in defining problems and proposing analysis methodologies.Contribute information and findings from studies.Perform other duties as assigned.Additional job responsibilities, at the SES.2 levelProvide solutions to moderately complex problems involving largely identifiable factors.Determine methods, techniques, and evaluation criteria using independent judgment.QualificationsAbility to secure and maintain a U.S. DOE Q-level security clearance, which requires U.S. citizenship, with sensitive compartment information (SCI) access.Bachelor’s degree in operations research, political science, engineering, physical science or a related field, or equivalent combination of education and related experience.Basic understanding of contemporary technical, military, and economic considerations as they relate to geopolitical competition.Science and technology knowledge and/or ability to understand issues related to nuclear weapon design, production, nonproliferation, and counterproliferation. Ability to effectively manage concurrent technical tasks with competing priorities and meet deadlines that are important to project success.Sufficient verbal, written, and interpersonal communication skills to collaborate effectively in a multi-disciplinary, multi-laboratory, and cross-functional team environment and explain technical information.Additional qualifications at the SES.2 levelAbility to work effectively with minimal guidance and proficient communication and interpersonal skills.Experience providing innovative approaches and applying new technical approaches to broadly defined tasks and projects.Comprehensive knowledge and broad experience applying effective analytical and problem-solving skills to moderately complex problems.Qualifications We DesireKnowledge relating to national security.Experience in conducting net assessments.Competence in one or more scientific programming languages or statistical analysis tools.Additional Information$84,840 – $148,560/year at the SES.1 level$101,80 – $178,200/year at the SES.2 levelActual salary will be determined after consideration of the selected candidate’s experience and qualifications.All your information will be kept confidential according to EEO guidelines.Position InformationThis is a Career Indefinite position, open to Lab employees and external candidates.Why Lawrence Livermore National Laboratory?Flexible Benefits Package401(k)Relocation AssistanceEducation Reimbursement ProgramFlexible schedules (*depending on project needs)Inclusion, Diversity, Equity and Accountability (IDEA) – visit https://www.llnl.gov/diversityOur core beliefs – visit https://www.llnl.gov/diversity/our-values Employee engagement – visit https://www.llnl.gov/diversity/employee-engagementSecurity ClearanceThis position requires a Department of Energy (DOE) Q-level clearance. Also, you must have the ability to obtain and maintain Sensitive Compartmented Information (SCI) access. If you are selected, we will initiate a Federal background investigation to determine if you meet eligibility requirements for access to classified information or matter. Also, all L or Q cleared employees are subject to random drug testing. Q-level clearance requires U.S. citizenship. Pre-Employment Drug TestExternal applicant(s) selected for this position must pass a post-offer, pre-employment drug test. This includes testing for use of marijuana as Federal Law applies to us as a Federal Contractor.Equal Employment OpportunityWe are an equal opportunity employer that is committed to providing all with a work environment free of discrimination and harassment. All qualified applicants will receive consideration for employment without regard to race, color, religion, marital status, national origin, ancestry, sex, sexual orientation, gender identity, disability, medical condition, pregnancy, protected veteran status, age, citizenship, or any other characteristic protected by applicable laws.We invite you to review the Equal Employment Opportunity posters which include EEO is the Law and Pay Transparency Nondiscrimination Provision.Reasonable AccommodationOur goal is to create an accessible and inclusive experience for all candidates applying and interviewing at the Laboratory. If you need a reasonable accommodation during the application or the recruiting process, please use our online form to submit a request. California Privacy NoticeThe California Consumer Privacy Act (CCPA) grants privacy rights to all California residents. The law also entitles job applicants, employees, and non-employee workers to be notified of what personal information LLNL collects and for what purpose. The Employee Privacy Notice can be accessed here.Videos To WatchApply Now Refine SearchClear AllCareer Areas Administrative (13) Business Operations (19) Craft and Skilled Trades (3) Engineering (162) Environmental, Safety & Health (20)Show MoreExperience Level Internship (7) Associate (55) Mid-Senior Level (225) Entry Level (114) Not Applicable (5) Executive (2) Director (2)Employment Type Intern (7) Full-time (403)Location Las Vegas, NV (1) Livermore, CA (399) Los Alamos, NM (1) Mercury, NV (1) Princeton, NJ (3) Tracy, CA (5)Organization Business (3) Chief Financial Officer (7) Computing (67) ESH and Quality (26) Engineering (149) Global Security (12) Human Resource Management (5) Infrastructure and Operations (5) NIF and Photon Science (11) Office of the Director (7) Operations and Business Office (9) Physical and Life Sciences (76) Security Organization (4) Weapons and Complex Integ (29)Show LessSecurity Clearance Active DOE L or Q clearance (3) Active DOE Q Clearance (27) Active DOE Q clearance (SCI) (4) Anticipated DOE L Clearance (2) Anticipated DOE Q Clearance (285) Anticipated DOE Q Clearance (SCI) (12) Either no clearance, DOE L or Q (7) None Required (64) None, U.S. Person (6)LLNL.GOVMissionsScience & TechnologyProgramsDoing BusinessNewsAboutCareersCommunityPROGRAMSWeaponsGlobal SecurityLasersPhysical and Life SciencesEngineeringComputingRESOURCESContactVisitingEmergency CommunicationResearch EthicsPrivacyCopyright and ReuseSite MapAccessibility AccommodationLCA NotificationsAffiliate OpportunitiesNorthwind Contract OpportunitiesCalifornia Privacy NoticeContact Careers HelpSTAY CONNECTED Lawrence Livermore National Laboratory | 7000 East Avenue • Livermore, CA 94550 | LLNL-WEB-458451Operated by the Lawrence Livermore National Security, LLC for the Department of Energy’s National Nuclear Security Administration Learn about the Department of Energy’s Vulnerability Disclosure Program Home Privacy & Legal Notice | https://www.llnl.gov/join-our-team/careers/find-your-job/not-applicable_associate_entry-level_internship_globalsecurity_officeofthedirector/all/3743990001435926 |
| Center for Strategic and International Studies | | https://csis-careers.netlify.app/opportunities/1324 |
| iPhone Photography School: IOS DeveloperHeadquarters: Riga, Latvia URL: https://iphonephotographyschool.com/What’s iPhone Photography School all about?We make online courses that help people take stunning photos with the iPhone.With our 9-year track record, we’re the world’s leader in mobile photography education.And while we’re proud of everything we’ve accomplished so far, we’re just getting started.And this is why we are looking for an experienced iOS Developer to join our team.What will you be doing as our iOS developer?Building our flagship iOS learning app to be used by over 500k active customersWorking closely with our design team to deliver an outstanding user experienceCollaborating with our backend development team to build the API used by the appContinuously developing new features for our customers after the app is launchedHelping to problem solve and fix any issues that arise in productionWhat’s in it for me?Of course this can’t all be one-sided, and we believe that we provide one of the best remote working environments in the world.State of the art software to stay connected and organized? We’ve got that.Investing both time and money in your learning to ensure that you continually grow? We do that.Flexible working schedule to ensure that you maintain a healthy work-life balance? Well that’s a no-brainer.But should you apply?This is not a decision we can make for you, but what we can do is lay out our Purpose, Values and Mission to help you decide for yourself.As a company we believe in honesty and transparency, and once you click the apply button you will have the chance to learn all about us before you decide on whether to submit your application.Hiring the best candidate is very important to us, but equally important is hiring the right candidate. Only apply if you really identify with what you read on the next page.Note: This is a 100% remote full-time position. Due to time zone differences, we won’t be able to hire applicants residing in Australia or the eastern parts of Asia.To apply: https://weworkremotely.com/remote-jobs/iphone-photography-school-ios-developer-1 | https://weworkremotely.com/remote-jobs/iphone-photography-school-ios-developer-1 |
| backstitch | TOTAL COMPENSATIONEMPLOYEE APPINTERNAL NEWSLETTERSBLOGSOLUTIONSSUPPORTCome JoinOur Growing TeamWe’re always looking for talented and passionate team members that want to grow their career at a fast-moving startup building products for the largest employers in their industry.Open Positions inKansas City, MOCome work in the heart of the KC Crossroads District. “2020 Top 10 Startups to Watch: backstitch”- Startland NewsFull-Stack Software EngineerThis role will have you take ownership over future customer-facing products as well as assist in scaling our existing suite of applications.ApplyProduct OwnerThe Product Owner helps ensure our software platform consisting of multiple web and mobile app products meets the needs of the market and the user.This role will require partnering and collaborating closely with multiple teams to collect customer-driven feedback, prioritize the product roadmap, and define software development scope.ApplyUI/UX Designerbackstitch is looking for a forward-thinking UI/UX Designer to help optimize the usability of our software platform consisting of multiple web and mobile app products. This role will require partnering and collaborating closely with multiple teams to plan product direction, collect customer-driven feedback, and define engineering scope.ApplyEnterprise Sales Executivebackstitch is looking for an experienced B2B Software Sales Executive looking to grow their career at a fast growing startup working with some of the most well known companies in the world.This position requires confidence to build relationships and solve challenges for Director, VP and C-suite level executives as you will be responsible for growing revenue across a national territory.Applybackstitch was named as one of:”Kansas City’s Top VC-Backed Companies in 2020″Read Article Benefits We Offer:100% Employer Covered Medical Plan.Flexible Schedule and Uncapped Paid VacationCompany Stock OptionsPerks We Offer:Free Snacks, Coffee, and BeerCasual Office Environment in the KC Crossroads DistrictRegular Company Events and OutingsBrand New 15″ Macbook Pro w/ Touch BarDual 24″ MonitorsiPad w/ Apple PencilStanding Desk Apply Now KANSAS CITY, MO1627 Main St. #1200Kansas City, MO 64108Google Maps Generator by embedgooglemap.netTopics we care aboutHow to Prioritize a Work Environment That Supports EveryoneHow Does Employee Engagement Affect the Employee Experience?Financial Wellness is the Key to Employee EngagementEmployment Law Changes for 2023Help Employees Make the Most of Their Benefits Before the Year EndsEmployment Law Changes for December 2022Celebrate Your Employees in the Company Newsletter This Holiday SeasonEncourage Employees to Use Their Wellness Benefits Over the HolidaysEmpower HR to Address Economic Uncertainty for Your EmployeesEmployment Law Changes for November 2022RESOURCESVirtual Open Enrollment GuideReturn to Work PlaybookABOUTEngagement PlatformMobile IntranetNewsletter CreationTotal RewardsInternal CommsHuman ResourcesHR BlogFree TemplatesCONTACTAbout UsContact UsHelp CenterRequest a QuoteJob OpeningsPrivacy PolicyPlatform Privacy PolicyFOLLOW US | https://www.backstitch.io/careers?job=6&utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Linkwell Health, Inc.: Contract Drupal Developer.Headquarters: 535 5th Ave, New York, NY 10017 URL: https://www.linkwellhealth.com/Linkwell Health, the premier consumer experience company serving health plans and health services organizations, seeks a Contract Drupal Developer to focus on Drupal upgrade work during the first half of 2023. The Contract Drupal Developer will work with Linkwell’s technology and product teams to upgrade and update the backend systems that support our content marketing and consumer engagement programs. In this position, your Key Performance Areas (KPAs) will include:Methodical Approach• Quickly assess and understand Linkwell’s technology solution.• Execute a plan to move Linkwell to Drupal 9.• Ensure features, security, and performance are retained in upgraded solution.• Identify opportunities to add features and value in the upgrade path. Technical Expertise• Deliver on product requirements within agreed upon schedules.• Demonstrate a proven ability to execute Drupal upgrades.• Solve problems when possible, seek answers when necessary. Teamwork• Contribute to the improvement of the current software in a team-first environment.• Work with a cross functional team on upgrading the solution set.• Communicate effectively with a fully remote team.In this position, your Key Performance Indicators (KPIs) will be:• Successfully move Linkwell onto Drupal 9.• Deliver stable, tested, production-ready code.• Transparency regarding timelines, obstacles, and resources.Our ideal candidate will have:• Bachelor’s degree in IS, CS or related field.• 5 + Years professional experience as a developer.• Experience leading Drupal upgrades in an enterprise environment.• Professional experience building APIs or similar content distribution solutions.• Expert understanding of APIs, REST, JSON:API, web publishing, and content management.• Experience working with Drupal and PHP.• Prior work in content marketing or publishing a plus.• An entrepreneurial spirit and team-first attitude. This position is fully remote but could require occasional travel to Linkwell’s New York City office.ABOUT US:Linkwell Health is the premier consumer experience company serving health plans and health services organizations. Our team of content strategists, health and wellness journalists, and social media experts—enabled by our Healthy Living Engine technology platform—helps healthcare brands to connect with consumers and empower them to take actionable control of their health. Linkwell creates transformative content that rapidly enables health services organizations to engage consumers in real-world health conversations, while also accelerating brand awareness, acquisition, retention, and business outcomes. For more information, visit www.linkwellhealth.com.To apply: https://weworkremotely.com/remote-jobs/linkwell-health-inc-contract-drupal-developer | https://weworkremotely.com/remote-jobs/linkwell-health-inc-contract-drupal-developer |
| ClickGUARD Inc.: Senior Frontend EngineerHeadquarters: America URL: https://www.clickguard.com/About the roleLeading the front-end development for our SaaS productImplementing new user-facing features using React.jsBuilding reusable components and front-end libraries Optimizing components for maximum performance across a variety of browsers and web-capable devices Translating user stories, specs, and wireframes into high-quality code that delivers value to the end-user Reporting to the Head of Product and Technical Team LeadWhat qualifies you for this role?You have strong Computer Science fundamentalsYou’ve demonstrated experience as a senior frontend developer using React.jsYou have excellent JavaScript knowledge in front end libraries and React.jsecosystemYou have deep experience with UI libraries and design systemYou are familiar with code versioning tools like gitYou have experience developing analytical, data-driven web applicationsYou have versatility in the JavaScript ecosystem and programming languages ingeneralClear background in building Software as a Service, ad tech, and/orcybersecurity techYou have experience with Test-Driven DevelopmentYou have experience working remotelyWhat’s in it for you?Competitive salary + performance bonusesSenior Frontend Engineer job description 2Work that fits your personality and lifestyleYour hours are flexible, and so is your vacationYou can work from anywhere in the world – We work remotely!Join and help shape the future of PPC advertisingOnce a year all expenses paid company get-togethersTo apply: https://weworkremotely.com/remote-jobs/clickguard-inc-senior-frontend-engineer | https://weworkremotely.com/remote-jobs/clickguard-inc-senior-frontend-engineer |
| Bottomless: Senior Full Stack DeveloperHeadquarters: Seattle, Wa URL: https://www.bottomless.com/We are looking for a jack-of-all-trades senior javascript/full stack developer.The ideal candidate for this position would be able to dive into any kind of project, from frontend UI/UX tasks in React.js to backend tasks running on Node.js.If you’re interested in variety and working hard to build something big, this might be a good fit.We need to achieve 80% of the results with 20% of the effort.Responsibilities:Design and build infrastructure and products for a sensor-enabled e-commerce marketplace.Build robust infrastructure to support existing product lines and the ability to roll out new ones.Responsibility over the user-facing productQuick iteration on different fronts from fronted UX changes to database design to quick and dirty implementations.Responsible for full deployment and testing of applications.Skill, Qualifications, and Experience:Expert proficiency required:Node.jsNoSQL databasesReact.jsEnglish (written and verbal)Intermediate proficiency, at a minimum:UI/UX designSoftware architectureNot required, but a plus:Python (background tasks)Embedded systems (C++) Details:Remote OK. Must be flexible with hours as we have a remote international team.Competitive equity and cash compensationTo apply: https://weworkremotely.com/remote-jobs/bottomless-senior-full-stack-developer-6 | https://weworkremotely.com/remote-jobs/bottomless-senior-full-stack-developer-6 |
| elearnio Gmbh: Senior Ruby on Rails Developer (m/f/x)Headquarters: Berlin, Germany URL: https://elearnio.com/deTo grow our development team, we are currently looking for a Senior Ruby on Rails Developer (m/f/x) . If you are passionate about understanding customer problems, designing solutions, and building the required software, let us talk. Your work can impact the future of digital learning & development for the years to come.TasksDevelop, shape and maintain our modern responsive frontend and backend applications in a test-driven manner within an agile environmentImprove our interactive learning environment by creating new features, and increasing its reliability and performanceDesign and improve APIs to enable integrations with other tools in the HR system tech stackDesign and improve a real-time reporting system for gaining insights into our customers’ learningIn a team, decide on all technical and design challenges and lay the foundation to scale our businessWe work withRuby on Rails in backend and Typescript and Javascript (Angular) ecosystem in frontendPostgreSQL and Redis, serverless hosting in AWS, using various AWS servicesCI/CD tooling with on-demand staging for every PRAutomated testing via SeleniumYou want to work primarily on backend tasks, go full-stack or combine dev and ops? It is your choice!RequirementsMinimum of 5 years of experience developing web applications using Ruby on RailsGreat understanding of relational and NoSQL databasesPassion for testing best practices; you can write unit tests and have experience in test automation frameworksExperience with CI, CD, and dev opsExperience working with modern front-end frameworks is a plusProven empathy for our customersKeen to take over end-to-end responsibilityFluent in EnglishBenefitsAfter your onboarding using our own tool, you will get responsibility and be able to contribute immediatelyWe are a startup and have a solid business, but are hungry for the next level of growth. You can be part of a joyful ride.We have offices Berlin and Potsdam in Germany, and we believe in the power of working remotely. So it is your choice from where you work.We support flexible working hours. So it is your choice when you work.elearnio is build on the idea of life-long learning. We offer a budget for your development and training needs.elearnio is committed to diversity, equity, and inclusion. We believe our team should reflect a rich diversity, so we encourage people of all backgrounds to apply. We’re an Equal Opportunity Employer and do not discriminate on the basis of race, color, gender, sexual orientation, gender identity or expression, age, religion, disability, national origin, veteran status, or any other status.To apply: https://weworkremotely.com/remote-jobs/elearnio-gmbh-senior-ruby-on-rails-developer-m-f-x-1 | https://weworkremotely.com/remote-jobs/elearnio-gmbh-senior-ruby-on-rails-developer-m-f-x-1 |
| Sitemate: Senior Mobile / Full Stack Engineer (SaaS)Headquarters: Sydney, Australia URL: https://sitemate.com👋 Thanks for stopping by and learning more about this role at Sitemate! ✨🏗️We’d love to hear from you 🙂 👩💻👩🏽💻🧑🏿💻👨🏻💻Brief overview of this role at Sitemate:We are looking for a senior level mobile / full stack software engineer to join our engineering team and lead our two React Native mobile projects.This role would be great for you if you are looking for more technical authority and autonomy around your work on mobile projects. Maybe you are working in a bigger team and don’t have any opportunities to take a lead role. Maybe you’ve worked in startups or had your own startup that has finished up, and you want to join a startup team that move quickly and place a huge emphasis on product and engineering.You will have opportunities such as becoming a foundational member of our engineering team, regardless of your location. You will have the opportunity to pull responsibility and technical ownership off of our CTO’s ‘plate’, and make it your own area of expertise. You will have the opportunity to learn (and improve) complex mobile-specific challenges such as sharing components between mobile applications, full offline mode, real-time syncing between mobile and web and native multimedia uploading. You will have direct engagement, collaboration and communication with our Head of Product, Head of Design & UX and product-focused CEO.Employment Type:Full-time.Preferred Based: Melbourne, Sydney, Remote Australia, America, Canada, Vancouver, Brazil, Asia (Philipines, Vietnam, Thailand, Malaysia, Indonesia) *Remuneration: AUD $130K-$220KWhy should I consider joining Sitemate?Check out Sitemate’s team at the 2022 offsite: https://youtu.be/DEPrINm_6SoYou can see what people really think about working at Sitemate here: https://www.glassdoor.com.au/Overview/Working-at-Sitemate-EI_IE3008131.11,19.htmListen to CEO Hartley Pike speak about the company’s founding and broader Go To Market strategy: https://www.linkedin.com/feed/update/urn:li:activity:6980676710161661952/Listen to CTO Tim Bray speak about building high quality features that solve customer problems at Sitemate: https://open.spotify.com/episode/7geTCUHFxZUKZ8Yrae4iR7We have equal opportunity for applicants of all genders, ethnicity and sexualities – Sitemate’s team is proudly diverse.You will have flexible working options – our team is a blend of fully remote and hubs around offices. People based in hub cities typically work in the office 2-3 days per week, and 2-3 days working from home.You will be remunerated based on your performance. If you are performing well, you won’t need to wait 3 years or have to find better offers elsewhere to receive an increase to your remuneration. 7 out of the last 10 remuneration increases for Sitemate team members have been made pro-actively by management, without the individual needing to even raise the topic of remuneration.You will get a laptop and a budget to set up your home office (standing desk, monitor, headphones etc).You will be able to attend company-sponsored training, workshops or conferences that help with your role.You will get additional benefits and support as parents – with paid leave for both primary and secondary carers (includes adoption), as well as support and leave for the tragic circumstances of stillbirth.You will get equity options and ownership in Sitemate on a standard vesting schedule. See here a general overview of how this works: https://legalvision.com.au/5-essential-elements-employee-share-scheme/Sitemate has grown from 5 people in 2018 to now over 40, and we’re now moving into the next stage of growing to 100 people! We have a product that customers are strongly engaged with, and every month we get around 300-400 new leads whilst spending $0 on marketing and 0 cold calling.Sitemate’s founders have diverse backgrounds – one with coming from engineering on major infrastructure projects such as roads, bridges and tunnels, the second coming from product and graphic design. This brings a unique perspective internally where we blend deep industry experience with a passion (obsession) for modern best practices in product design.Sitemate graduated from Australia’s #1 Technology Company Accelerator – Startmate (complete coincidence on the names… 😅).Sitemate has strong financial backing from Blackbird (Australia and NZ’s #1 Vc) and Shearwater Growth Capital (founded by two Directors of WiseTech – a $14B software company for the logistics industry).What is the working environment like at Sitemate?We are very transparent – monthly allhands meetings provide the team with direct insight into team updates, customer stories, hiring plans and key metrics (NPS, Revenue, Financial Performance). During this allhands meeting we also hear one ‘life story’ from one of our team each month – learning about different countries and cultures around the world.We place an extremely high value on your time – you won’t be spending your days wasting time on fighting internal systems, botched together spreadsheet processes or doing data entry.We use best in class systems that are seamlessly integrated to deliver our team the right information at the right time, allowing them to get their work done efficiently and to a very high standard.You will have a core and close team around you, but you will also be exposed to and working directly with multiple departments – engineering, product, design, marketing, sales and customer success.You will have a high degree of autonomy, as the focus is on outcomes and not hours. If you want to block off a few hours to run a personal errand – no worries. If you want to block off an hour to pick up the kids from school – no worries. No one will be monitoring your time.We are constantly working to minimise the number of group meetings – daily check ins are all done asynchronously (in your own time) each morning. But spontaneous 1:1s or small sessions are strongly encouraged!What does Sitemate do, exactly?Sitemate builds best in class software products for the built world.Industrial companies operating in the built world are facing a number of mission critical challenges – changes in work behaviour due to covid-19, Generation Z starting to enter the workforce as mobile first users of software, and the drastic shift away from traditional mining to renewable energy projects such as wind farms and solar farms.See here an example wind farm project that is powered by Sitemate: https://roadbridge.ie/projects/beinn-an-tuirc-windfarm-phase-3/See here an example solar farm project that is powered by Sitemate: https://newenglandsolarfarm.com.au/the-project/Our first product – Dashpivot, is a platform where industrial style companies streamline and standardise their processes in a new digital format. This new digital format enables them to complete and track work in the field on a mobile or tablet, and automate repetitive tasks and tracking through automated workflows and real-time analytics.See some of our user reviews for Dashpivot here:Capterra:https://capterra.com/p/178010/Dashpivot/G2 Crowd: https://www.g2.com/products/dashpivot/reviewsTrust Radius: https://www.trustradius.com/products/dashpivot-by-sitemate/reviews?o=recentWhat will I be doing day to day in this role?Take technical ownership of our two mobile products & their backends – developing new features, fixing bugs, re-architecting core components functions.Inheriting the technical vision for our mobile products from our CTO, improving it, and ensuring all work day to day is working towards this technical vision.Working closely with our delivery team (product owner & QA Engineers), product team and broader engineering team. As a senior engineer, you will be expected to coordinate the mobile projects and will be the point of contact for our CTO and CEO.Assisting our delivery team with diagnosing any production issues by investigating bugsnag and datadog logs, and then creating hotfix releases accordingly.What will be the biggest challenges for me in this role?As you will be working directly with our CTO (a former founder) and our Founder/CEO, you will need to be able to manage communication, problem solving and your own technical execution/contributions.You will need to be acutely aware of your own productivity and ensure that you are always driving towards outcomes that will impact users.Our mobile products seem simple to our users, but contain a high degree of technical complexity – from shared components across multiple mobile apps, to backend services that only serve the mobile client – there will be a lot to learn.We will be completely re-architecting our product’s hierarchy in the next 12 months from a rigid tree/folder structure to a flexible tree/folder structure, which will nearly certainly require refactoring every part of our product 🙃.What kind of skills and experience do I need to have? (Ideally most but not all)Javascript/Typescript experience is preferred.React Native experience is preferred.Node, Serverless & AWS experience a bonus.MongoDB & DynamoDB experience is a bonus.Native mobile experience is a bonus (as per above, we are planning on forking a portion of our React Native app to enable the usage of native components for multimedia uploading).FAQsWhat does the application and interview process look like? And how long does it take?Once you have expressed interest, we have an online application form that is connected to our internal systems. Following on from this, we have a combination of an online self service quiz and interviews. Usually it will only take a day or two to hear an update on next steps, and the overall process for those who make it all the way through, will usually take a couple of weeks.*Note for remote candidates – Sitemate has a standardised COL (Cost of Living) multiplier that is applied to the remuneration bands shown, based on your location, it may go up or down.To apply: https://weworkremotely.com/remote-jobs/sitemate-senior-mobile-full-stack-engineer-saas | https://weworkremotely.com/remote-jobs/sitemate-senior-mobile-full-stack-engineer-saas |
| Proxify AB: Senior Python Engineer: Long-term job – 100% remoteHeadquarters: Sweden URL: http://career.proxify.ioThe Role:We are searching for a Senior Python Developer. You can be a perfect candidate if you are growth-oriented, you take pleasure in your work, and you enjoy working on new ideas to develop exciting products. By joining Proxify, you will get considerable opportunities to work with leading brands and amazing startups to build their next product and growth features. What we are looking for:You have +3 years of experience with Python and Flask;You have +2 years of experience with Kubernetes;You follow best practices and conventions;Relevant experience in CI/CD and related tools;Responsible and able to work with minimal supervision;Upper-intermediate English level;You can communicate well with both technical and non-technical clients.Nice-to-have: Interest in cryptocurrency is a huge plus.Timezone: CET (+/- 3 hours);Responsibilities:Writing reusable, testable, and efficient code;Design and implementation of low-latency, high-availability, and performant applications;Integration of user-facing elements developed by front-end developers with server-side logic;Implementation of security and data protection;Integration of data storage solutions.What we offer:💻 100% remote work: Work from anywhere.👌🏻 Flexibility: The ability to change the project to another one.💵 Financial growth: Competitive compensation and performance-based increases.🧘🏻♂️ Freedom: Very flexible working schedule.🚀 360 degree growth: Opportunities for professional development and personal growth.Your benefits with Proxify:Be part of the Proxify community: Network with like-minded and enthusiastic individuals to make a difference. Make an impact: You get the opportunity to work on projects that inspire you and add value to your career.Transparency: Contracts with transparency in earnings and working hours.Save your time: Fast and efficient hiring process to match you with the project of your preference.Ownership: Take ownership of your work and enjoy more freedom in your career.To apply: https://weworkremotely.com/remote-jobs/proxify-ab-senior-python-engineer-long-term-job-100-remote | https://weworkremotely.com/remote-jobs/proxify-ab-senior-python-engineer-long-term-job-100-remote |
| Mobile Game ProducerPerBlue is looking for our next great Mobile Game Producer to join our team of experienced mobile game creators. We’re a growing independent studio whose free-to-play midcore mobile games are being played by millions of people around the world, including the award-winning Disney Heroes: Battle Mode. Our team brings together experience from major studios in the videogame and technology industries. Headquartered in Madison, Wisconsin, we also work remotely around the United States and Canada for an unmatched quality of life and work. As our game producer, you’ll focus on managing the daily operations of a game team. You’ll work directly with and report to a Product Owner (PO). While the PO focuses on overall strategy, the Producer focuses on tactical project management, including sprint management, filing, and tracking dev tasks, organizing standups, running playtests, and more. The PO and Producer will work closely together to ship a great game on time and on budget. Principal ResponsibilitiesYou’ll have a strong understanding of agile development theory and practice. You’re self-motivated, focused on results, and have the ability to thrive in a dynamic fast-paced environment. You enjoy working in a collaborative space and are good at staying organized and on task. Manage the day-to-day development process for a free-to-play mobile RPG or strategy gameWork with a cross-functional team to deliver sprints on time, on budget, and at a high-quality barQuickly identify when development issues arise, diagnose their cause, and implement solutions to keep the product and team on trackMake valuable individual contributions to the product (via design, QA, UX, analysis, etc.)Recommending and implementing new processes where efficiencies are needed to improve timely or on-budget deliveryEnsuring all necessary project documentation is complete and up-to-dateEstablishing and maintaining a productive and communicative working environment Your experience1+ years in a game producer role Excellent communication skills (verbal, written, interpersonal)Excellent knowledge of agile methodology Positive attitude, calm and deliberate within a highly dynamic, fast-paced environment Additional qualifications to highlight in your applicationFree-to-play mobile game production experience Experience with mid-core game genres and mechanics (especially RPG & strategy)Project management training and certificationKnowledge of the NFL, sports games/football experienceKnowledge of NFTs and blockchain in gaming If you’re thinking that your past experiences don’t meet every single one of our requirements and preferences perfectly, please still consider applying for this role. We seek diversity in people, experiences, and perspectives, and we’re committed to building a genuine, diverse, and inclusive workplace. If you clicked into this posting and you’re excited about this role, you may just be the candidate we’re looking for, so go on and apply! Compensation and BenefitsMedical Insurance (70% employer paid – $0 deductible plan)Dental + Vision Insurance (50% employer paid)Short-term/Long-term Disability (100% employer paid)Group Life Insurance (100% employer paid)Supplemental Life Insurance (voluntary, employee paid)401(k) + 5% Employer Match18 days Paid Time Off + Company Holidays (including a 2-week Winter Break!)All-company Onsite Weeks + Gap DaysFlexible schedules with emphasis on providing work life balanceAnnual Professional Development Time OffCareer growth minded with opportunities for promotions and potential transfers into different departments The base salary range for this full-time position is $40,000 to $89,000 USD + bonus. Our salary ranges are determined by role, level, and location. The range displayed on each job posting reflects the minimum and maximum target for new hire salaries for this position across all locations nationwide.While this base salary range represents our best estimate for this role, factors such as experience and job knowledge will play a part in compensation decisions. So if you’re intrigued by what we’re doing – apply and let’s chat! No agencies, please. This is a pretty good description of this position’s roles and responsibilities but is not a comprehensive job description, so duties and supervisors may change. We regret that we cannot consider visa sponsorship or candidates based outside of the United States or Canada for this position at this time. | https://remotive.com/remote-jobs/software-dev/mobile-game-producer-1629328 |
| OnBase Developer – API/WVOnBase Senior Solution Consultant – WorkView/API Certified | Remote Work AllowedJob SummaryDue to steady growth and demand, Kiriworks is looking to grow our Professional Services team. We are searching for talented Senior Solution Consultants with advanced OnBase ECM platform/integration experience (REQUIRED) who are motivated to build world class customer solutions. Our Solution Consultants work with our customers to build technological solutions that enable them to work faster, smarter and more efficient. There is great variety in this role – from business analysis/requirement gathering to solution design/development, implementation and training.Kiriworks offers a flexible, fun work environment and provides a competitive compensation package that includes health/dental/vision/disability/life (and pet!) insurance, PTO, 401k and much more. We also offer an honest, integrity-based work environment that encourages professional growth through experience and paid training.Experience/Skill Requirements for Solution Consultants:Bachelor’s degree in Management Information Systems, Information Technology, or equivalent experience.4+ years of experience as an OnBase Administrator or OnBase Solution Consultant, including experience in designing and implementing WorkView solutions. Preferred certifications/experience: OnBase Certified WorkView DeveloperMinimum 2 years of development experience with the OnBase APICertified OnBase API Developer (OCAPI)Application development/scripting experience for custom OnBase integrationsEstablished success in a team and project environment, actively working with a Project Manager and customer resources to complete tasks within the project constraints.Strong communication (written and verbal) with the ability to communicate to both technical and non-technical teammates & customers. Strong documentation skills required.Strong organizational skills, with the ability to multi-task.Ability to travel up to 20% of the time (post-Covid). Travel time may vary with training and project requirements.Proficient in Microsoft Office Suite.Other desired skills/certifications:Other Hyland certifications (OnBase Certified Installer, OnBase Certified Workflow Engineer, Hyland Certified Brainware Installer, etc.).Experience and familiarity with consuming REST APIs via C# or JavaExperience in implementing OAuth / OpenID ConnectSignificant experience with MSSQL experience. LocationMilwaukee, Wisconsin/Cleveland, Ohio or remoteJob TypeFull Time | https://remotive.com/remote-jobs/software-dev/onbase-developer-api-wv-1629550 |
| Cachet | | https://cachet.bamboohr.com/jobs/view.php?id=33&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Stockly | | https://www.welcometothejungle.com/fr/companies/stockly/jobs/partner-operations_paris?q=ae8ba7eee57056b2ed992a6416f42b04&o=1070553&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Stockly | | https://www.welcometothejungle.com/fr/companies/stockly/jobs/cdi-business-success-associate_paris?q=ae8ba7eee57056b2ed992a6416f42b04&o=1281317&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Stockly | | https://www.welcometothejungle.com/fr/companies/stockly/jobs/cdi-sales-associate_paris?q=ae8ba7eee57056b2ed992a6416f42b04&o=1317847&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Stockly | | https://www.welcometothejungle.com/fr/companies/stockly/jobs/strategic-partnership-manager_paris?q=ae8ba7eee57056b2ed992a6416f42b04&o=1463527&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Senior Software Engineer (Ruby)Who We Are:CirrusMD is a different kind of telemedicine company. In less than a minute, patients reach a live, licensed physician and conduct a care encounter at their pace and convenience. Available 24/7/365, CirrusMD’s integrated care is delivered via multispeciality, board-certified doctors who can treat a broad range of conditions, from acute to chronic, primary care to specialty areas, including behavioral health. CirrusMD is available to 10 million users across all 50 states, and exclusively offered through employers and health plans. Learn how CirrusMD is transforming virtual care: https://www.cirrusmd.comWho We’re Looking For:We are looking for an experienced full stack software engineer with Ruby expertise to join our engineering team to contribute to our mission of redefining the healthcare experience for patients and providers. You’ll be responsible for delivering high value products and end-user experiences while improving yourself and those around you each day. You will be part of our patient team that is focused on the mobile and web experience for the duration of a patient’s visit, from eligibility to onboarding and connecting with a provider.We are an engineering driven organization and our tech stack includes modern versions of Ruby, Rails, React, React Native & Native Mobile, Typescript, and AWS with some Python, Go and other technologies mixed in. A career with CirrusMD is an opportunity to work with some of the best and brightest minds, disrupt the healthcare industry and greatly impact millions of lives by enhancing our platform.What You’ll Accomplish: Build performant APIs, and end user experiences A reputation for reliably delivering well considered, well tested and performant code product(s) Contributions to our evolving development and testing standards and best practices High collaboration with Design + Product ensuring balanced code complexity and UX RequirementsWhat You’ll Bring 6+ years of experience shipping full stack features using Ruby on Rails Strong experience with JavaScript frameworks (React specifically a plus) Proficiency with semantic markup and modern Javascript and CSS patterns Experience designing REST APIs Proficiency with modern developer workflows and tools (Git/Github, CI, etc) Experience writing tests for your code at all layers (Rspec, Jasmine/Jest) Solid understanding of foundational software design patterns Your philosophy aligns with Agile methodologies and processes Significant experience giving and receiving feedback in code reviews Confidence pairing with other engineers Proficiency with SQL and relational databases What Will Make You Stand Out: Craftsperson tendencies taking significant pride in both the process and the outcomes of your work Strong command of SQL and experience optimizing query and application performance Knowledge of static typing using TypeScript or Flow Experience with Apollo / GraphQL / Jest / Storybook You firmly understand how to be a successful team player Strong engagement within the Ruby and/or JS ecosystems Proficiency with Go or Python BenefitsWhy CirrusMD?Make a lasting impact in healthcare! Recognized as a top place to work by BuiltIn CO, CirrusMD is paving the way to a better healthcare future and our work truly matters. We are enabling easier access to healthcare for millions of people. You’ll have a chance to make real contributions to the health and wellness of our communities. Telehealth is one of the fastest growing industries and now, more than ever, there is unlimited opportunity to take charge & shape your career at CirrusMD. We take the health and happiness of our employees seriously and offer outstanding benefits including: Company funded & deeply subsidized benefit options for you and your family that begin day 1 Work life balance with our responsible Unlimited PTO / Vacation program 401(K) + match & stock options Paid maternity & paternity leave Remote friendly (with the option to work out of our Denver HQ) Growth opportunity A positive, collaborative and diverse culture Social events onsite & remote Free, unlimited access to our chat based platform If you are looking to make a lasting impact where your voice matters, consider joining our team.The base salary range for this position is $150,000-170,000/year. Actual pay may vary based on job-related skills, qualifications, certifications, experience and location. This role may also be eligible for a discretionary bonus in addition to equity incentives and a comprehensive benefits package.CirrusMD is committed to creating a diverse and inclusive workforce and is proud to be an equal opportunity employer. We aim to create a workplace that celebrates the diversity of our employees, users, and customers. We strive to deliver products and services that work for everyone by including perspectives from backgrounds that vary by race, ethnicity, social background, religion, gender, age, disability, sexual orientation, veteran status, and national origin.Notice to recruiters and placement agencies: If you are a recruiter or placement agency, please do not submit résumés to any person or email address at CirrusMD prior to having a signed agreement with Human Resources. CirrusMD is not liable for and will not pay placement fees for candidates submitted by any agency other than its approved recruitment partners. Also, any résumés sent to us without an agreement in place will be considered your company’s gift to CirrusMD and may be forwarded to our Talent Acquisition team. | https://remotive.com/remote-jobs/software-dev/senior-software-engineer-ruby-1620460 |
| Hack The Box | Marketing Operations SpecialistWelcome! Super excited you dropped by 🥳Join our mission to create and connect cyber-ready humans and organizations through highly engaging hacking experiences that cultivate out-of-the-box thinking. (Find out more insights about Hack The Box culture on our career site).About Hack The BoxHack The Box is a massive hacking playground, and infosec community of over 1.0m platform members who learn, hack, play, exchange ideas and methodologies. We are an online cybersecurity training platform that allows individuals, businesses, universities, and all kinds of organizations all around the world to level up their offensive and defensive security skills through a fully gamified and engaging learning environment.Exciting News: In Jan 2023 we secured $55 Million in Series B Funding Led by Carlyle 🚀 The new investment will accelerate Hack The Box’s growth trajectory with a focus on further building out its category-defining “gamer-first” solutions offering. Hack The Box will also enhance its go-to-market function, doubling down on the company’s ongoing international expansion with strong commercial traction in the US, Europe, and APAC.About the roleWe are seeking an experienced Marketing Operations Specialist to join our team. In this role, you will be responsible for managing and optimizing our marketing automation systems, with a focus on HubSpot. You will work closely with the marketing team to execute campaigns, track performance and analyze data to drive results.As a Marketing Operations Specialist, you will be responsible for managing demand and ensuring the integrity of our data structure and integrations. Additionally, you will work to improve lead flow and create processes that can accommodate growth. Your efforts will help to increase efficiency and drive better results for our marketing campaigns.Regarding the team members, you will be part of a dynamic, goal-oriented marketing team that values open, honest, and collaborative communication. This role offers ample opportunity for career progression and the ability to explore various areas within marketing operations, such as data analysis, campaign management, and more. Additionally, this role provides a lot of responsibility that will allow you to excel in your area as well as expand in creative areas of interest. ResponsibilitiesManage and optimize our marketing automation systems, with a focus on HubSpotWork with the marketing team to execute campaigns and track performanceAnalyze data to drive results and make data-driven decisionsDevelop and implement processes to improve efficiency and effectiveness of marketing operations and success metricsCollaborate with other teams to ensure seamless integration of marketing automation and analytics systemsTurn Hack The Box’s ecosystems into one universe to assure a unified experience between our hacking community and our enterprise customersRequirements3+ years of experience in marketing operations, with a focus on CRM automation (familiarity with HubSpot is definitely a plus)Strong understanding of marketing automation best practices and principlesExperience with data analysis and reportingStrong project management skillsExcellent communication and collaboration skillsAn eye for detailBonus pointsFamiliarity with data & analytics software (e.g., Segment, Databox, Google Analytics, etc.) will be considered a plusFamiliarity with B2B marketing metrics will also be considered a plus (we love our CPA and CAC)BenefitsWhy do you want to work at Hack The Box?You’ll have the chance to shape the industry of cybersecurity trainingYou’ll be able to grow as we grow and solve challenging problems working with people all over the worldYou’ll collaborate with an international, friendly and talented team of individualsYou’ll definitely enjoy working with us 🥳We have also other benefits that will keep you happy:Private insuranceFree lunch & snacks at the office25 annual leave daysDedicated budget for training and professional development, participation in conferencesState-of-the-art equipment (mac, iPhone, and mobile plan)Full access to the Hack The Box lab offerings; so you can learn how to hackFlexible/Hybrid working – Can be fully remoteSelection Process:A conversation with the Talent Acquisition team to know us better and to share more info about HTB and the roleA bit more of a technical conversation with the hiring manager to get a better understanding of your experience and achievementsA challenge related to the job and conversation about the way you have approached it. This will really help us understand your skillset and have a fair selection process.Offer 🎉 | https://remotive.com/remote-jobs/marketing/marketing-operations-specialist-1621547 |
| (35) Lead Fullstack Javascript DeveloperProtofire is looking for a Lead Fullstack Developer to join our DAO, make architecture decisions and lead the team.What you need to succeed:Leadership experienceProactive and willing to take ownership of the projectsExcellent communication levelDeFi Protocol experience or knowledgeArchitect mindsetDevOps experience5+ years of experience building open-source code that is clean, maintainable, and well-tested, for production networks at scale2+ years of experience leading engineering teams in blockchain, crypto, or Web3.2 + years of experience working with Typescript and Node.js2+ years of experience with Ethers/Web3.js or Polkadot.js2 + years of experience working with React.js and Node.jsTheoretical knowledge of blockchains and distributed systemsExperience working with container technologies like DockerA passion for decentralized, peer-to-peer systems and Web3 technologies.Desired or Bonus experience:Business and customer-oriented mindsetFinance knowledgeExperience with the Rust programming languageFamiliarity with Substrate and the Polkadot ecosystem.How is this opportunity any different from others?Co-founder rewards without the risk: You’ll get a fixed USD salary + share of revenue generated by the project you work in + stock options of Protofire, – ownership of Protofire itself, including its profits, revenue, and tokens such as SNX, MKR, GNO, OCEAN, MKR, GRT, DOT, LINK.Career development on steroids: You’ll be encouraged to learn and grow your own qualification, or to teach others through constant and valuable feedback from your peers. You’ll get a higher salary and PROTO token if you show that you learned/grew your qualification.Highly performant team: You’ll be working with senior Engineers that are hired based on their ability to learn and ship products that users want and love. As a mature and autonomous team, you will do what you and the rest of your engineering team believe is best. You can change architecture decisions if you believe that is better for the user. | https://remotive.com/remote-jobs/software-dev/35-lead-fullstack-javascript-developer-1620206 |
| Stockly | | https://www.welcometothejungle.com/fr/companies/stockly/jobs/business-developer-alternance_paris?q=ae8ba7eee57056b2ed992a6416f42b04&o=1491358&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Stockly | | https://www.welcometothejungle.com/fr/companies/stockly/jobs/intern-business-developer_paris?q=ae8ba7eee57056b2ed992a6416f42b04&o=1491960&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Stockly | | https://www.welcometothejungle.com/fr/companies/stockly/jobs/cdi-account-executive_paris?q=ae8ba7eee57056b2ed992a6416f42b04&o=1571009&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Stockly | | https://www.welcometothejungle.com/fr/companies/stockly/jobs/operateur-operatrice-de-service-client-cdd-paris_paris?q=ae8ba7eee57056b2ed992a6416f42b04&o=1645292&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Stockly | | https://www.welcometothejungle.com/fr/companies/stockly/jobs/agent-operationnel-le-cdd-paris_paris?q=ae8ba7eee57056b2ed992a6416f42b04&o=1645299&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Stockly | | https://www.welcometothejungle.com/fr/companies/stockly/jobs/operateur-operatrice-de-saisie-cdd-paris_paris?q=ae8ba7eee57056b2ed992a6416f42b04&o=1645303&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Palmetto | PalmettoSign in with LinkedInSoftware Development Engineer IIPalmetto United States (Remote)Posted 3 days agoFull-timeEngineeringIT Services and IT ConsultingRenewable Energy Semiconductor ManufacturingApplyMeet the hiring teamCourtney Tutt KochelTalent Acquisition CoordinatorJob PosterAbout the jobCompany DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleWe are looking for a passionate full-stack engineer proficient with the MERN stack (MongoDB, Express, React.js, Node.js) and the Ionic Mobile framework. You will be an integral part of a multi-discipline team responsible for the full software development life cycle of our platform. As a member of the Palmetto Engineering team, you’ll be working in an Agile development environment with a team that prides itself on innovation, is focused on product development, and doesn’t shy away from solving difficult business problems.We’re looking for someone who is energetic, self-motivated, team-oriented and enjoys being a key contributor in an entrepreneurial environment. You’ll work alongside – not for – UX designers, product managers, and other engineering team members. This isn’t a task-receiving role; we want your hands, brains, and heart to make solutions and shape the platform’s future.Strategic & TacticalDesign both client-side and server-side solutions with a focus on the server-side system and API layer.Develop and manage well-functioning applications and databasesWrite comprehensive E2E and unit tests to verify functionalityTroubleshoot, debug, and upgrade softwareCollaborate across teams to identify and develop best practices, design patterns, and reusable codeActively participate in code reviews and provide constructive feedback to safeguard product qualityCraft solutions that satisfy near-term objectives while enabling future growth and scalabilityQualificationsExperience designing and consuming RESTful APIsStrong proficiency in JavaScript, including DOM manipulation and the JavaScript object model5+ years of professional engineering experienceExperience with Node.jsRelevant working experience using popular SPA frameworks and document-model databasesExcellent written and verbal communication skillsA desire to never stop learning, a deep passion for technology, and a collaborative mindset to work with others to ensure end-to-end design and deliveryA strong work ethic, exceptional problem-solving skills, and an interest in tackling diverse technical challenges. Design and develop quality code that follows best practices and adheres to Palmetto standardsOpenness to collaboration through formal and informal code and PR review processesPreferred QualificationsExperience with ES6+ language featuresExperience in React and isomorphic React is a plusKnowledge of modern authorization mechanisms, such as JSON Web TokenFamiliarity with modern front-end build pipelines and toolsExperience with at least one common development tool such as Babel, Webpack, NPM, Yarn, etc.Ability to understand business requirements and translate them into technical requirementsA knack for benchmarking and optimizationFamiliarity with code versioning tools such as GitExperience with agile development practices, TDD, and pair-programmingEmployment is contingent upon the successful completion of a background check.Equal Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.Unit TestingNoSQLNode.jsREST APIsSoftware DevelopmentJavaScriptMongoDBJSONGitReact.jsLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3524256129?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=kZ8xEmt3jnAM%2FOONIY6%2F5g%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | PalmettoSign in with LinkedInHR GeneralistPalmetto United States (Remote)Posted 2 weeks agoFull-timeHuman ResourcesIT Services and IT ConsultingRenewable Energy Semiconductor ManufacturingApplyMeet the hiring teamHilary ThompsonSenior Talent Acquisition Manager at PalmettoJob PosterAbout the jobCompany DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleThe People & Culture (P&C) team is seeking an HR Generalist to support the team as we navigate an exciting period of growth as a result of increased efficiency and productivity within the company. As an HR Generalist, you will work closely with two Senior HRBPs and provide vital support that will allow the team to strategically support business needs.Strategic & TacticalEfficiently handle tactical responsibilities as directedMaintain, monitor, and create documentation to track employee informationProvide support through the full employee life cycle, including but not limited to onboarding, engagement and retention initiatives, training support, employee relations, and offboardingPull metrics and analyze data in partnership with P&C team members to establish trends that influence projects and drive solutionsMaintain communications and timelines for critical HR initiativesQualifications3+ years of diverse, HR generalist experience, preferably in a high-growth small to midsize (200-1000 employees) companyExperience with both Talent Management and Employee Relations is requiredAbility to navigate ambiguity and handle competing prioritiesHigh attention to detailProven time management skills and ability to handle multiple tasks and projects simultaneouslyTechnical aptitude and ability to efficiently use or quickly learn G-suite productsEmployment is contingent upon the successful completion of a background check.Equal Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based on race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.Human Resources (HR)Organization SkillsAttention to DetailCommunicationTime ManagementGoogle WorkplaceHR MetricsHR PoliciesEmployee RelationsTalent ManagementFeatured benefitsEmployer-providedMedical insurance, dental insurance, vision insurance, paid maternity leave, paid paternity leave, student loan assistance, tuition assistance, and disability insuranceLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3475905342?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=CpfJjx19Itl4oSw%2FYfgUcg%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Senior Software Engineer (m/f/d)Pitch is the collaborative presentation platform for modern teams. With a focus on real-time collaboration, smart workflows, and intuitive design features, we make it fast and delightful for teams to create and deliver beautiful presentations. Our presentation and template galleries give everyone the ability to publish their own standout work, learn from one another, and find the creative spark for their next presentation. Tens of thousands of teams have made the switch to Pitch, including top brands like Intercom, Superhuman, and Notion. We’ve raised over $135 million to date, and have been recognized by FT-backed Sifted as Europe’s Top B2B Soonicorn in 2022. And we’re just getting started.We’re looking for a Senior Software Engineer to join one of Pitch’s core product teams. You’ll join a cross-functional team to build features that supercharge our users’ ability to communicate their ideas. If you’re interested in pushing the boundaries of browser-based interfaces to solve tangible problems, love functional programming, and want to be part of a diverse, remote-first team of visionaries, we’d love to hear from you! Curious about our engineering culture? Our CTO and co-founder Adam Renklint recently contributed to a blog post that dives deep into our technical foundation, our iterative approach to development and our philosophy on building a sustainable engineering culture that’s all about joyful work. For further reading on our team’s values, check out our Engineering Principles.What you’ll get to doYou will join a team of experienced developers building high impact features for our users driven by design, user research, and metrics. Your work will be mostly be frontend focussed but you will be expected to occasionally work on backend services, tooling, and infrastructure.You will collaborate with peers to define architecture, quality standards, and best practices.You will work closely with our designers, teaming up in small cross-functional teams to bring features from idea to prototype to final implementation with a high degree of autonomy.Who we are looking forYou love shipping Single Page Applications and bringing delightful user interactions to life.You ensure code quality and system security through automation, unit testing and structured code reviews.You are product oriented, combining thoughtfulness with pragmatism and a will to get stuff done. You are calm and focused under pressure, and consider work-life balance essential for long-term happiness and productivity.You have extensive experience with React.js and other Javascript libraries.You are proficient in a backend programming language like Clojure (or equivalents such as Golang, Python, or Node.js)You enjoy breaking complex tasks down into small deliverables and iterating with a focus on a delightful user experienceYou believe effective and successful work is made possible by clear and honest communication, with a shared understanding of the long-term vision and immediate next actions. When you don’t fully understand something, you ask lots of questions and use the opportunity to learn and grow.Curious what it’s like to work at Pitch? Find out more about how Pitch operates as a remote-first company through using powerful collaboration tools and dogfooding our own products!Pitch was founded in Berlin, but as a remote-first company, our team works together from all over the world. With that mindset, we’re building an inclusive workplace that invites diverse perspectives, and values talent from diverse personal and professional backgrounds. For more specifics on how we honour our commitment to diversity in our hiring process, check out our Recruiting D&I Pledge.Sounds like a good fit? Join us on our mission to enable every team’s best thinking – we look forward to hearing from you!Not quite sure whether that’s a role for you? No problem! If you can’t find any open role that caught your eye, but are interested in working at Pitch, you can always submit your resume here. We will follow up as soon as we open up a position that matches your skillset and aspirations! | https://remotive.com/remote-jobs/software-dev/senior-software-engineer-m-f-d-1619759 |
| Stockly | | https://www.welcometothejungle.com/fr/companies/stockly/jobs/charge-de-service-client-cdd-paris_paris?q=ae8ba7eee57056b2ed992a6416f42b04&o=1645307&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Stockly | | https://www.welcometothejungle.com/fr/companies/stockly/jobs/ressources-humaines-stage-paris_paris?q=ae8ba7eee57056b2ed992a6416f42b04&o=1645314&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Stockly | | https://www.welcometothejungle.com/fr/companies/stockly/jobs/finance-stage_paris?q=ae8ba7eee57056b2ed992a6416f42b04&o=1649808&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Stockly | | https://www.welcometothejungle.com/fr/companies/stockly/jobs/assistant-recrutement-stage-paris_paris?q=ae8ba7eee57056b2ed992a6416f42b04&o=1680649&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Stockly | | https://www.welcometothejungle.com/fr/companies/stockly/jobs/assistant-recrutement-stage-paris_paris_STOCK_Zkpoozw?q=ae8ba7eee57056b2ed992a6416f42b04&o=1680653&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Stockly | | https://www.welcometothejungle.com/fr/companies/stockly/jobs/back-end-developer-rust-grpc-postgresql_paris?q=ae8ba7eee57056b2ed992a6416f42b04&o=421986&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Innovation Upstream Inc: Sr. Frontend Developer (React/Web3)Headquarters: Winnipeg, MB, Canada URL: https://innovationupstream.comAbout the position:Innovation Upstream is seeking a talented and motivated React developer who is experienced in working on large scale distributed systemsThis role will focus on coding in react, and candidates would benefit strongly from having a deep fundamental software development knowledge base.We are building multiple web3 projects and are seeking a passionate and talented frontend developer who can join our rapidly growing team.The role is currently remote and you can work from anywhere. You will be responsible for collaborating on projects with client development teams. You will be expected to manage various competing deadlines, and projects. Teamwork, problem-solving, accountability, and good communication skills are necessary.What you will be doing:Building web3 frontends and integrating with various wallets and smart contractsBuilding complex and performant frontends with react and integrating with GraphQL apisIntegrating with a software development team and working closely with a technical project managerConducting technical due diligence and understanding dynamics/tradeoffs between different software development technologies and approachesWe’re looking for someone who has:Strong engineering fundamentals3+ years of software engineering3+ years of React development experience1+ years of web3 development experienceStrong familiarity with Linux/Terminal environmentsDepth of knowledge and implementation experienceCreativity in solving problemsBeing open to providing and receiving constructive feedbackPassion for learning and teaching othersCI/CD setup experienceHigh-quality testing standardsGood documentation practicesTo apply: https://weworkremotely.com/remote-jobs/innovation-upstream-inc-sr-frontend-developer-react-web3 | https://weworkremotely.com/remote-jobs/innovation-upstream-inc-sr-frontend-developer-react-web3 |
| Senior Full Stack Software EngineerCompany DescriptionJohn Snow Labs is an award-winning AI and NLP company, accelerating progress in data science by providing state-of-the-art software, data, and models. Founded in 2015, it helps healthcare and life science companies build, deploy, and operate AI products and services. John Snow Labs is the winner of the 2018 AI Solution Provider of the Year Award, the 2019 AI Platform of the Year Award, the 2019 International Data Science Foundation Technology award, and the 2020 AI Excellence Award.John Snow Labs is the developer of Spark NLP – the world’s most widely used NLP library in the enterprise – and is the world’s leading provider of state-of-the-art clinical NLP software, powering some of the world’s largest healthcare & pharma companies. John Snow Labs is a global team of specialists, of which 33% hold a Ph.D. or M.D. and 75% hold at least a Master’s degree in disciplines covering data science, medicine, software engineering, pharmacy, DevOps and SecOps.Job DescriptionWe are looking for an exceptional full-stack software engineer to join a growing team and take on building web services and apps for John Snow Labs NLP libraries. The right candidate will have substantial proven hands-on experience with Python 3, JavaScript or TypeScript; deep understanding of full-stack and client-side web development, working knowledge of existing tools and frameworks for UI development, and a passion for high-quality code and design.Mush haves:- Strong knowledge and practice of writing reliable web applications.- Experience with Python 3, backend frameworks, and distributed task queues.- Teamwork practices (git flows, code reviews, issue trackers).- Experience with Docker and Kubernetes.- Familiarity with CI/CD and automated testing.- Passion about user experience.- Experience with running software in a Linux environment.- Interest in modern technologies and desire to learn something new.Good to have:- A GitHub account with public contributions.- Awareness about Spark and Jupyter notebooks.- Frontend stack: JavaScript or TypeScript, HTML, CSS, building tools.Also required is experience working in industry delivering production-grade software projects, working as part of an agile software team and using tools like GitHub and Docker.If you are a good fit for this job, please include the words John Snow Labs in your response and explain why you are the right person for this job. This is potentially a full-time, long-term freelancing opportunity, with substantial opportunities to learn new technologies and grow your career.QualificationsMush haves:- Strong knowledge and practice of writing reliable web applications.- Experience with Python 3, backend frameworks, and distributed task queues.- Teamwork practices (git flows, code reviews, issue trackers).- Experience with Docker and Kubernetes.- Familiarity with CI/CD and automated testing.- Passion about user experience.- Experience with running software in a Linux environment.- Interest in modern technologies and desire to learn something new.Good to have:- A GitHub account with public contributions.- Awareness about Spark and Jupyter notebooks.- Frontend stack: JavaScript or TypeScript, HTML, CSS, building tools.Also required is experience working in industry delivering production-grade software projects, working as part of an agile software team and using tools like GitHub and Docker.If you are a good fit for this job, please include the words John Snow Labs in your response and explain why you are the right person for this job. This is potentially a full-time, long-term freelancing opportunity, with substantial opportunities to learn new technologies and grow your career.Additional InformationAll your information will be kept confidential according to EEO guidelines. | https://remotive.com/remote-jobs/software-dev/senior-full-stack-software-engineer-1620249 |
| Front-End EngineerABOUT USBuilt for fast-growing companies, Transifex’s open, cloud-based platform helps push digital content across multiple languages and accelerates the delivery of content with a continuous localization workflow. Customers using Transifex can be assured that new content is always translated, and the latest translations are included with each release. This means faster time to market and a better experience for end users. Transifex has customers in nearly 50 countries representing about 40,000 projects and over 320,000 users, localizing content in 150+ languages.Transifex believes that diversity enhances the ability to deliver our first class software services. Our workplace is discrimination-free and we are committed to ensuring equal employment opportunities. Our belief is that diversity of background, experience and perspectives promotes both a better environment for our employees and a better user/customer platform. These are key values we trust in and we invite all qualified applicants to join the #remotefirst world of Transifex.While considering this position, take into account what we value here at Transifex. We are looking for someone who aims to:Be a true teammateConsistently growAdvocate for the CustomerTruly own itBe your whole self RESPONSIBILITIESWork with Product Designers to improve how our customers interact with Transifex.Build intuitive interfaces.Identify and address performance bottlenecks.Participate in design and code reviews.Grow our Backbone.js expertise and help us build great user experiences.Useful notes: Tips on getting your resumé read.Resumés in English please.RequirementsExcellent communication skills in English, particularly written communication.Proficiency in HTML/HTML5, CSS/CSS3 and LESS or SaSS.Passion for clean, Web standards compliant practises.Good knowledge of Javascript.Previous experience in software development and product development is considered a plus.Experience with Django, Backbone.js and other js templating languages is a plus.Comfort in a fast-paced, entrepreneurial, start-up environment.If you feel your experience does not match some of these requirements, we’d appreciate if you specified it on your application.BenefitsThe health of our company and the success of the SaaS product we offer is directly related to the work environment we create for ourselves. With this in mind, we strive to create a welcoming and positive place in which to work and thrive. For our employees, we offer:Fully Remote & Flexible Work EnvironmentPaid Time Off & HolidaysPaid Sabbatical Leave and other types of leaveLearning OpportunitiesTop notch equipment of your choiceEquipment allowance to set up your home officeMonthly remote-work stipendCompany Fun EventsCalm Meditation App SubscriptionYoga sessionsAmazing culture and close-knit team | https://remotive.com/remote-jobs/software-dev/front-end-engineer-1629884 |
| Stockly | | https://www.welcometothejungle.com/fr/companies/stockly/jobs/back-end-developer-intern-rust-grpc-postgresql-nodejs_paris?q=ae8ba7eee57056b2ed992a6416f42b04&o=422091&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Stockly | | https://www.welcometothejungle.com/fr/companies/stockly/jobs/full-stack-developer-intern_paris?q=ae8ba7eee57056b2ed992a6416f42b04&o=454467&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Stockly | | https://www.welcometothejungle.com/fr/companies/stockly/jobs/front-end-developer_paris?q=ae8ba7eee57056b2ed992a6416f42b04&o=454501&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Stockly | | https://www.welcometothejungle.com/fr/companies/stockly/jobs/front-end-developer-intern_paris?q=ae8ba7eee57056b2ed992a6416f42b04&o=726680&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Oper Credits | | https://join.com/companies/oper/7501733-podcast-marketing-intern-zuerich?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Oper Credits | | https://join.com/companies/oper/7498166-podcast-marketing-intern?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Koala | | https://www.welcometothejungle.com/fr/companies/koala-insurance/jobs/senior-business-developer_paris?q=30d738df13d610ba5170c4a853ef180b&o=1694167&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Koala | | https://www.welcometothejungle.com/fr/companies/koala-insurance/jobs/senior-product-manager_paris?q=30d738df13d610ba5170c4a853ef180b&o=1694222&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Koala | | https://www.welcometothejungle.com/fr/companies/koala-insurance/jobs/experienced-typescript-backend-developer_paris?q=30d738df13d610ba5170c4a853ef180b&o=1694679&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Senior Software Engineer About Ukio |Ukio’s mission is to empower individuals to live where they want, when they want 🌎.We do this by disrupting the traditional residential real estate market, providing fully furnished and artfully designed apartments for stays starting at one month. We remove all the hassle around finding a rental with no long-term contracts, moving/buying furniture, security deposits, broker fees, etc. giving choice and flexibility to allow people to live where and when they want. 💥We are a Barcelona based startup with offices in Madrid, Lisbon, Berlin and Paris. Soon we will conquer some more cities across Europe 🚀Backed by Europe’s best Venture Capital firms, the next year will be a critical phase in our growth as we look to further build out our team and expand into multiple new markets 🔥 . We have successfully raised €27 million in ourSeries A investment round in 2022 that will help propel our growth throughout Western Europe. 🥇 Our culture |We honor diversity, compassion, and honesty above all else in our team. We’ve already got a great mix of dedicated, collaborative, and results-driven people and are looking for more like minded folks to join our team. In true startup fashion, we always embrace the unknown and grant full autonomy to our team members to act as the owners of their projects and tasks. We are creators who embrace dynamic environments and take on and build up projects from scratch.Our team is composed of everyone from foodies to athletes, adventure seekers to art buffs. We know fun, and we always have a team event on our calendars, so are you ready to join us? Role |This is a unique opportunity to see out and work in developing Ukio’s products from very early conception to the final stage. Working 100% remotely you will join a highly skilled, forward-thinking team working in a cross-discipline manner. As a start-up, and with Ukio’s unique culture you can expect an exciting environment, with a lot of room for innovation, new ideas and suggestions. You will work on development and maintenance of the company’s main commercial platform but also internal tools, in fact, our main focus is creating those tools so we can help other teams to optimize their time or improve certain flows. You will lead a significant part of the implementation and deployment of these projects. Responsibilities |Responsible for the end-to-end software development process, working closely with the team to scope, design, and deploy innovative new features.Code review and support high quality standards, ensuring best practices are fulfilled and we release only the highest quality productsLiaise with our product manager and the rest of the team members/leads to identify opportunities for improvement and optimization of existing projects.Contribute to analysis of projects including performance, diagnosis, and troubleshooting.Act as an example to others in your team, encouraging and mentoring Junior Engineers in your craft.Objectively explore multiple approaches and recommend the best technical direction including logic and reasoning. About you |5-10 years working experience in a professional programming positionExperience with Docker, and ideally AWS ECS (if you have worked with k8s the transition will be easy)Proficient with database technologiesUnderstand the importance of testing and the tradeoffs between different types of testingAttention to detail and problem-solving abilityAbility to analyze data and communicate ideas clearly so the whole team can be in the loopAbility to independently learn new technologies.Proven ownership of an engineering initiative.Fluent English is requiredFlexible, resilient and content with ambiguity and changes.Confident with working in cross-functional teams.Comfortable performing in a start-up environment. Ukio’s life benefits |Bonus SchemeFlexible scheduleFully Remote (work from home)Investment in your learning and developmentEmployee Stock Options PlanA challenging job at one of the fastest growing companies in EuropeCompetitive annual gross salary, to be determined in line with your knowledge and experiencePrivate InsuranceInternational working environment with many different nationalitiesWork with talented, committed and supportive teammatesTeam events and an amazing internal cultureUkio’s culture promotes and values each individual’s contribution. Diversity and inclusion, it’s a big topic for us, as such we encourage applications from individuals of all backgrounds, regardless of age, gender, ethnicity, disability, sexual orientation, gender identity, socio-economic background, religion and/or belief.Sky’s the limit for us. We’re here to revolutionize your life. Be part of this revolution 🔥 We look forward to receiving your application! For more information about Ukio, visit us at www.ukio.com and to keep up to date with UKIO’s news, follow us on LinkedIn and Instagram! | https://remotive.com/remote-jobs/software-dev/senior-software-engineer-1629443 |
| Search Engineer – Front EndSearch Engineer – FrontendRemoteAbout BraveBrave is on a mission to protect the human right to privacy online. We’ve built a free web browser that blocks creepy ads and trackers by default, a private search engine with a truly independent index, a browser-native crypto wallet, and a private ad network (opt-in!) that directly rewards you for your attention. And we’re just getting started. Already 50 million people have switched to Brave for a faster, more private web. Millions more switch every month.The internet is a sea of ads, hackers, and echo chambers. Big Tech makes huge profits off our data, and tells us what’s true and what’s not. Brave is fighting back. Join us!SummaryBrave Search is looking for talent to make search.brave.com better. Your work will impact the future of search to be used by millions of people. Brave search engine is fully autonomous and independent with its own ranking, crawling and indexes, aiming to offer a true alternative to Microsoft and Google. Plenty of challenges, if that triggers you and feel you can contribute, do not hesitate to apply. Job Description:As a Frontend Engineer you will be part of our search team and work very closely with our Design, Product, Business Development and Marketing teams.Search is a very performance-sensitive application and you will be responsible for front-end, and some back-end, development. You will own, build, and develop new and existing capabilities into the search page.You should be very familiar with HTML, CSS, Python, Javascript and have strong design principles. We currently use a mixture of tools but are primarily using Fastapi and Svelte. If you obsess over fast, performant, and beautiful web applications then you should apply.ResponsibilitiesCommunicate with Design, Product to determine requirements and assets for functionality on the Brave Search web application.Maintain existing components and features on Brave Search.Effectively translate designs into performant and fully responsive pages or apps. This occasionally involves offering design suggestions in order to better accommodate various screen sizes. Ensuring high-performance and availability.Keeping us to a high security standardWork collaboratively with geographically-distributed team members to help identify and fix bugsLocationAnywhere, but European timezones preferred (or at least a significant overlap with European timezones).RequirementsDeep understanding of HTML, CSS, JavaScript.Advanced knowledge of Python.Experience working with a design team to implement a front-end design system. Experience developing API Gateways.Experience working with a front-end framework/library such as React, Vue, Angular, or Svelte.Experience building a responsive website across various screen sizesUnderstanding of security issues surrounding all aspects of the front-endAbility to work fast and under tight deadlinesNice to havesRemote work experience Experience with Svelte.Understanding CDN systems, cache purgingExperience deploying and managing AWS services and web appsWorking at BraveIndustry-leader in privacy, with a research and engineering team that’s innovating everyday to keep people safer online and beat Big TechHighly competitive salaries & benefits, and generous home-office stipendsFully remote team (no office, no commute)Welcoming, humble, ridiculously smart teammates, and a truly flat org structureOpportunity to get in early at a hyper-growth company, and revolutionize the webOh, and did we mention Brendan, our CEO & co-founder, invented JavaScript?United States Candidates: The salary range for this role is $70,000 – $200,000 USD, depending on experience.Check us outLinkedIn | Glassdoor | brave.com | https://remotive.com/remote-jobs/software-dev/search-engineer-front-end-1629907 |
| backstitch | | https://www.backstitch.io/cs/c/?cta_guid=365dddb6-74ab-4139-8251-79739644b2b1&signature=AAH58kEVMPb5Qq5a71cp3Xh1VKqwqn1yLg&pageId=5610906026&placement_guid=f32b2ebe-b9d8-42d4-a8e4-61265e38cad2&click=dfebde5c-14de-4fe2-9329-639ce1b027bb&hsutk=e7735f92900edd9461e35cba755a58fa&canon=https%3A%2F%2Fwww.backstitch.io%2Fcareers&portal_id=731034&redirect_url=APefjpEDQXGSZsq9tJz9i9qj9crr2xHM3TSru_NQDj-7Plxv_n7_3jYv5IMKr3bhcC8DqIybrao5MaYYLxX8wo4iMALpBjHHkzdAd8V-lP_OHQqWL4Xp2ZaqsE5F9vwD7u1RjlA9p0azRjlOlSM2joHOfLujalq0_g&__hstc=139043244.e7735f92900edd9461e35cba755a58fa.1679318064651.1679318064651.1679318064651.1&__hssc=139043244.1.1679318064652&__hsfp=1302673943&contentType=standard-page&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| backstitch | | https://www.backstitch.io/cs/c/?cta_guid=7771380d-86c8-4381-904b-003957426911&signature=AAH58kFgfkkpnAE9UEdWKxaan9bAJXJFtg&pageId=5610906026&placement_guid=9ae86810-3071-423f-83f8-7c37ab20081f&click=36d863cd-e35a-4e69-ac76-56b165c15eba&hsutk=e7735f92900edd9461e35cba755a58fa&canon=https%3A%2F%2Fwww.backstitch.io%2Fcareers&portal_id=731034&redirect_url=APefjpGy35kmgHaToDcIg1uyGedk2JaANjRUmXnKVA12Zg2uSOuNaAhticmdg3kByNhJSyviHMbarWrlANfFRF0GIm3cfX4wsJiLT9D4xRNhpZfRbF4XVq3oSArBfI4Vn2ml5_gdZJmWYoFf3g1bv0KS-1N15gU9jg&__hstc=139043244.e7735f92900edd9461e35cba755a58fa.1679318064651.1679318064651.1679318064651.1&__hssc=139043244.1.1679318064652&__hsfp=1302673943&contentType=standard-page&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| backstitch | | https://www.backstitch.io/cs/c/?cta_guid=767313f5-b86c-4499-9f8c-e431b9518565&signature=AAH58kGNwwhzLP7jrs0XXtIaOekNNFViUw&pageId=5610906026&placement_guid=6c84a022-06ed-4de9-b1d7-20702e84000b&click=c59dae80-5090-4177-9bca-0ffe5540c6d1&hsutk=e7735f92900edd9461e35cba755a58fa&canon=https%3A%2F%2Fwww.backstitch.io%2Fcareers&portal_id=731034&redirect_url=APefjpEZ4xY8dgHsFPNLH6WgKpeoL9mK-jJVbAiHldJCAoozCbn7mhQDtjiO7xSMNyIS94bqLD-DOCBhcnfY8dW0YdshEYInvcwoHH_T4P2ilC9VUisP6jSjycZ03hzfd_8XkK_1cfoC1AxIuvxrryqSeJnkKy5FFQ&__hstc=139043244.e7735f92900edd9461e35cba755a58fa.1679318064651.1679318064651.1679318064651.1&__hssc=139043244.1.1679318064652&__hsfp=1302673943&contentType=standard-page&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| backstitch | | https://www.backstitch.io/cs/c/?cta_guid=291f15ba-2a26-4ca6-8c3d-fd2246b80bc8&signature=AAH58kFJgUdMh39_Kc2oMujZfO6Wb2znMA&pageId=5610906026&placement_guid=db5fd7ab-2327-4f74-89d5-f0df5800c44b&click=1adffd6c-82cd-4db1-a836-e0a6105affab&hsutk=e7735f92900edd9461e35cba755a58fa&canon=https%3A%2F%2Fwww.backstitch.io%2Fcareers&portal_id=731034&redirect_url=APefjpHh2joP2iC2gBWav2pVx38nqlS0oPzadRYcrrJEw7HZAP9RZkrd4f_8LeIETayb3pnuAcr9uMJY4MQBkz8BLt-FUJrg6BeWyiKdDILhGHc9Jl6yYugXGUqvNKAnWC_O8JoCTz2dVmqqiGbJQEwbgSMpZEgWAw&__hstc=139043244.e7735f92900edd9461e35cba755a58fa.1679318064651.1679318064651.1679318064651.1&__hssc=139043244.1.1679318064652&__hsfp=1302673943&contentType=standard-page&utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Cledara | | https://join.com/companies/cledara/7493463-customer-success-manager-smb-growth?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Loadzpro | | https://www.linkedin.com/jobs/view/hot-shot-owner-operator-make-7000-to-10000-a-week-no-cdl-required-at-loadzpro-3507285809?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Loadzpro | | https://www.linkedin.com/jobs/view/hot-shot-owner-operator-make-7000-to-10000-a-week-no-cdl-required-at-loadzpro-3505386616?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Loadzpro | | https://www.linkedin.com/jobs/view/hot-shot-owner-operator-make-7000-to-10000-a-week-no-cdl-required-at-loadzpro-3511321018?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Loadzpro | | https://www.linkedin.com/jobs/view/hot-shot-owner-operator-make-7000-to-10000-a-week-no-cdl-required-at-loadzpro-3511318468?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Loadzpro | | https://www.linkedin.com/jobs/view/hot-shot-owner-operator-make-7000-to-10000-a-week-no-cdl-required-at-loadzpro-3515383812?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| US Government, Congressional Budget Office | Jobs Visiting Scholars Internships People BenefitsRecruiting Events Diversity and InclusionCommunications AssociateJob Category: CommunicationsDivision Name: Office of the DirectorDescriptionCBO’s Office of Communications seeks an intern with a strong work ethic to assist with the agency’s media relations and public affairs. The position, which could start as soon as May 2023, would last for the summer and could extend into the fall. The successful candidate will report to the Director of Communications and will serve as a key member of the communications team. Duties include responding to phone and email inquiries from the media and the public on a wide range of topics, attending and preparing for Congressional hearings, coordinating meetings with outside groups and international visitors, helping with preparations before the release of CBO’s major recurring reports, and working on other communications projects and planning as needed.Previous communications associates have served a frontline role representing CBO and have interacted routinely with staff in every part of the agency.QualificationsCandidates must be working toward a degree, preferably in journalism, mass communications, strategic communications, public relations, public policy, or a related field. Specifically, they must either be on track to earn a bachelor’s degree by May 2023 or May 2024 and have applicable experience, or they must be in a master’s degree program in one of those fields.Candidates should be strongly interested in public policy or political science and able to thrive in a fast-paced environment, effectively handling multiple tasks and completing projects under tight deadlines. Strong written and oral communications skills and the ability to work independently and as part of a team are required. Previous experience in journalism, media relations, or public affairs is desirable, as are familiarity with and interest in social media.Salary and BenefitsThe hourly rate will be between $21 and $28 and will be commensurate with educational attainment and related experience. The selected candidate would be expected to provide in-person communications support for meetings and events. Will consider current students who can work a part-time schedule between February and May (up to 32 hours). The selected candidate would be expected to work full-time during the summer. This is a temporary position that will not exceed one year.How to ApplyPlease submit a cover letter, a résumé, unofficial transcripts, and contact information for two references at www.cbo.gov/careers. Candidates working toward a master’s degree must also submit a list of coursework for the summer/fall semester. Incomplete applications will not be considered. To ensure consideration, apply by March 20, 2023 . This position is covered by the Veterans Employment Opportunities Act of 1998 as made applicable to CBO by the Congressional Accountability Act, as amended.ContactAnnita Gulati or Kate Green, Washington, DC, [email protected] RETURNING APPLICANTSIf you have previously applied to CBO, you are a returning applicant and should log back in with your email address and password to access your application materials. We encourage you to review and update them prior to submitting your new application.Previous Applicants:Email: Password: If you do not remember your password click here.If you are eligible for veterans’ preference and have previously applied to positions that were not covered by the Veterans Employment Opportunities Act (VEOA) and are now applying for a position that is covered by VEOA, please be sure to update your application to indicate your eligibility.Back to Search ResultsNew Search | https://phg.tbe.taleo.net/phg03/ats/careers/requisition.jsp?org=CONGRESSIONALBUDGET&cws=1&rid=612 |
| Palmetto | PalmettoSign in with LinkedInSales Representative Experience (Sx) ManagerPalmetto Charlotte, NC (Hybrid)Posted 2 days agoFull-timeSalesIT Services and IT ConsultingRenewable Energy Semiconductor ManufacturingApplyMeet the hiring teamCourtney Tutt KochelTalent Acquisition CoordinatorJob PosterAbout the jobCompany DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleIn this role, you will lead engagement marketing efforts to grow and retain our Sales Representative network, with a primary focus on driving projects through to completion. This is the launch of a high-touch service for Sales Representatives to provide a thorough, white-glove concierge experience. You will be the face of Palmetto inside the residential solar sales community, representing our services and our brand.Strategic & TacticalProactively support Sales Partners, at the Sales Representative level, to help them progress their projects forwardWork onside with operations to self-drive projects forward, navigating to resolutions without escalationSingle point of contact for a Sales Representative with ‘white-glove’ service. The Sales Representative is your client. Support email, phone, and SMS channels.Document Standard Operating Procedures and gather feedback from the Sales Representative Director and the respective operations teamsUnderstand the Sales Representative is highly incentivized to achieve installation status and your objective is to progress projects to installation completion within the SLA targetsResponsible for covering a dedicated assigned list of projects at any given timeWork within Alchemy and document all Customer Experience communications in Palmetto tools and comms hubDocument learnings and provide feedback to product and operationsQualifications2-4 years experience – preferably in an operational roleMarketplace or eCommerce experience preferredA love for working with people and a knack for creative problem solvingProven ability to partner across different groups to achieve a common goalWillingness to go above and beyond to provide an exceptional customer experienceExperience in the solar industry is preferred but not requiredEmployment is contingent upon the successful completion of a background check.Equal Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.Solar IndustrySalesE-CommerceService-Level Agreements (SLA)Project ManagementEngagement MarketingCustomer ExperienceStandard Operating Procedure (SOP)Creative Problem SolvingProblem SolvingFeatured benefitsEmployer-providedMedical insurance, dental insurance, vision insurance, paid maternity leave, paid paternity leave, student loan assistance, tuition assistance, and disability insuranceLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3525730678?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=sKsA2IBk+d+xEpAo6w9pCQ%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Sitemate Services Pty Ltd: Senior Mobile EngineerHeadquarters: Sydney, Australia URL: https://sitemate.com👋 Thanks for stopping by and learning more about this role at Sitemate! ✨🏗️We’d love to hear from you 🙂 👩💻👩🏽💻🧑🏿💻👨🏻💻Brief overview of this role at Sitemate:We are looking for a senior level mobile / full stack software engineer to join our engineering team and help lead our two React Native mobile projects.This role would be great for you if you are looking for more technical authority and autonomy around your work on mobile projects. Maybe you are working in a bigger team and don’t have any opportunities to take a lead role. Maybe you’ve worked in startups or had your own startup that has finished up, and you want to join a startup team that move quickly and place a huge emphasis on product and engineering.You will have the opportunity to pull responsibility and technical ownership, and make it your own area of expertise. You will have the opportunity to learn (and improve) complex mobile-specific challenges such as sharing components between mobile applications, full offline mode, real-time syncing between mobile and web and native multimedia uploading. You will have direct engagement, collaboration and communication with our Head of Product, Head of Design & UX and product-focused CEO.Employment Type:Full-time.Preferred Based: Melbourne, Sydney, Remote Australia, Asia, America, Brazil *Remuneration: AUD $130k-$180k.Why should I consider joining Sitemate?Check out Sitemate’s team at the 2022 offsite: https://youtu.be/DEPrINm_6SoYou can see what people really think about working at Sitemate here: https://www.glassdoor.com.au/Overview/Working-at-Sitemate-EI_IE3008131.11,19.htmListen to CEO Hartley Pike speak about the company’s founding and broader Go To Market strategy: https://www.linkedin.com/feed/update/urn:li:activity:6980676710161661952/Listen to CTO Tim Bray speak about building high quality features that solve customer problems at Sitemate: https://open.spotify.com/episode/7geTCUHFxZUKZ8Yrae4iR7We have equal opportunity for applicants of all genders, ethnicity and sexualities – Sitemate’s team is proudly diverse.You will have flexible working options – our team is a blend of fully remote and hubs around offices. People based in hub cities typically work in the office 2-3 days per week, and 2-3 days working from home.You will be remunerated based on your performance. If you are performing well, you won’t need to wait 3 years or have to find better offers elsewhere to receive an increase to your remuneration. 7 out of the last 10 remuneration increases for Sitemate team members have been made pro-actively by management, without the individual needing to even raise the topic of remuneration.You will get a laptop and a budget to set up your home office (standing desk, monitor, headphones etc).You will be able to attend company-sponsored training, workshops or conferences that help with your role.You will get additional benefits and support as parents – with paid leave for both primary and secondary carers (includes adoption), as well as support and leave for the tragic circumstances of stillbirth.You will get equity options and ownership in Sitemate on a standard vesting schedule. See here a general overview of how this works: https://legalvision.com.au/5-essential-elements-employee-share-scheme/Sitemate has grown from 5 people in 2018 to now over 40, and we’re now moving into the next stage of growing to 100 people! We have a product that customers are strongly engaged with, and every month we get around 300-400 new leads whilst spending $0 on marketing and 0 cold calling.Sitemate’s founders have diverse backgrounds – one with coming from engineering on major infrastructure projects such as roads, bridges and tunnels, the second coming from product and graphic design. This brings a unique perspective internally where we blend deep industry experience with a passion (obsession) for modern best practices in product design.Sitemate graduated from Australia’s #1 Technology Company Accelerator – Startmate (complete coincidence on the names… 😅).Sitemate has strong financial backing from Blackbird (Australia and NZ’s #1 Vc) and Shearwater Growth Capital (founded by two Directors of WiseTech – a $14B software company for the logistics industry).What is the working environment like at Sitemate?We are very transparent – monthly allhands meetings provide the team with direct insight into team updates, customer stories, hiring plans and key metrics (NPS, Revenue, Financial Performance). During this allhands meeting we also hear one ‘life story’ from one of our team each month – learning about different countries and cultures around the world.We place an extremely high value on your time – you won’t be spending your days wasting time on fighting internal systems, botched together spreadsheet processes or doing data entry.We use best in class systems that are seamlessly integrated to deliver our team the right information at the right time, allowing them to get their work done efficiently and to a very high standard.You will have a core and close team around you, but you will also be exposed to and working directly with multiple departments – engineering, product, design, marketing, sales and customer success.You will have a high degree of autonomy, as the focus is on outcomes and not hours. If you want to block off a few hours to run a personal errand – no worries. If you want to block off an hour to pick up the kids from school – no worries. No one will be monitoring your time.We are constantly working to minimise the number of group meetings – daily check ins are all done asynchronously (in your own time) each morning. But spontaneous 1:1s or small sessions are strongly encouraged!What does Sitemate do, exactly?Sitemate builds best in class software products for the built world.Industrial companies operating in the built world are facing a number of mission critical challenges – changes in work behaviour due to covid-19, Generation Z starting to enter the workforce as mobile first users of software, and the drastic shift away from traditional mining to renewable energy projects such as wind farms and solar farms.See here an example wind farm project that is powered by Sitemate: https://roadbridge.ie/projects/beinn-an-tuirc-windfarm-phase-3/See here an example solar farm project that is powered by Sitemate: https://newenglandsolarfarm.com.au/the-project/Our first product – Dashpivot, is a platform where industrial style companies streamline and standardise their processes in a new digital format. This new digital format enables them to complete and track work in the field on a mobile or tablet, and automate repetitive tasks and tracking through automated workflows and real-time analytics.See some of our user reviews for Dashpivot here:Capterra: https://capterra.com/p/178010/Dashpivot/G2 Crowd: https://www.g2.com/products/dashpivot/reviewsTrust Radius: https://www.trustradius.com/products/dashpivot-by-sitemate/reviews?o=recentWhat will I be doing day to day in this role?Work with the mobile team on our two mobile products & their backends – developing new features, fixing bugs, re-architecting core components functions.Help set and ensuring all work is working towards the technical vision.Working closely with our delivery team (product owner & QA Engineers), product team and broader engineering team. As a senior engineer, you will be expected to coordinate the mobile projects and will be a point of contact for our CTO and CEO.Assisting our delivery team with diagnosing any production issues by investigating bugsnag and datadog logs, and then creating hotfix releases accordingly.What will be the biggest challenges for me in this role?As you will be working directly with our CTO (a former founder) and our Founder/CEO, you will need to be able to manage communication, problem solving and your own technical execution/contributions.You will need to be acutely aware of your own productivity and ensure that you are always driving towards outcomes that will impact users.Our mobile products seem simple to our users, but contain a high degree of technical complexity – from shared components across multiple mobile apps, to backend services that only serve the mobile client – there will be a lot to learn.We will be completely re-architecting our product’s hierarchy in the next 12 months from a rigid tree/folder structure to a flexible tree/folder structure, which will nearly certainly require refactoring every part of our product 🙃.What kind of skills and experience do I need to have? (Ideally most but not all)Javascript/Typescript experience is preferred.React Native experience is preferred.Node, Serverless & AWS experience a bonus.MongoDB & DynamoDB experience is a bonus.Native mobile experience is a bonus (as per above, we are planning on forking a portion of our React Native app to enable the usage of native components for multimedia uploading).FAQsWhat does the application and interview process look like? And how long does it take?Once you have expressed interest, we have an online application form that is connected to our internal systems. Following on from this, we have a combination of an online self service quiz and interviews. Usually it will only take a day or two to hear an update on next steps, and the overall process for those who make it all the way through, will usually take a couple of weeks.*Note for remote candidates – Sitemate has a standardised COL (Cost of Living) multiplier that is applied to the remuneration bands shown, based on your location, it may go up or down.To apply: https://weworkremotely.com/remote-jobs/sitemate-services-pty-ltd-senior-mobile-engineer | https://weworkremotely.com/remote-jobs/sitemate-services-pty-ltd-senior-mobile-engineer |
| Center for Strategic and International Studies | | https://csis-careers.netlify.app/opportunities/1325 |
| The Good Food Institute | | https://gfi.org/job/?gh_jid=6669598002 |
| Palmetto | PalmettoSign in with LinkedInSenior Operations ManagerPalmetto United States (Remote)Posted 1 month agoFull-timeCustomer ServiceIT Services and IT ConsultingRenewable Energy Semiconductor ManufacturingApplyMeet the hiring teamCourtney Tutt KochelTalent Acquisition CoordinatorJob PosterAbout the jobCompany DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleThe Senior Operations Manager is responsible for overseeing and executing on Palmetto’s operational project pipeline from Engineering Complete to Install Ready across a six to ten-state geographic footprint. To accomplish this goal they will lead a cross-functional team of utility, permitting, and HOA subject matter experts. This role is focused on the velocity and throughput of projects and is thus accountable for ensuring the tactical efficiency and efficacy of this pipeline segment. The Sr. Operations Manager is responsible for identifying impediments to the timely execution of the departmental workflow and collaborating with Team Leads, Customer Leads, and Programmatic owners to overcome obstacles. The Senior Operations Manager will also be responsible for personnel allocation across states as volume and personnel availability are required to ensure an unhindered workflow.Strategic & TacticalDrive state and regional initiatives that accelerate project timelines from Engineering Complete to Install Ready and Inspection Complete to PTOLead and coach the Third Party Approvals team (Permitting, Utility, and HOA) to identify pipeline bottlenecks and implement team-wide solutions to course correctStrategically allocate and manage personnel resources to optimize installation-ready throughput across the regionCollaborate with the programmatic team to implement efficiency improvements that will increase team resource productivityPartner with technology on workflow automation and efficiency solutions for your teamMotivate and drive your team to monthly and quarterly install-ready and timeline goal achievementDevelop and drive initiatives toward reducing fallout/cancellations in the post-CR pipelineCollaborate with Customer Leads to ensure industry-leading timelines and customer experienceOther responsibilities as requiredQualificationsYou are motivated to solve complex problems and think creatively to overcome obstaclesYou thrive under pressure and are motivated by achieving goalsYou enjoy the opportunity to lead and develop teammates7+ years of operational leadership experience with a demonstrated track record of process improvement and leadership capability4+ years experience in managing multiple manager-level teams via metrics and KPIsDemonstrated leadership capabilities in a fast-paced, change-oriented environmentStrong understanding of the rooftop solar life cycle requirements from sale to PTO, and deep experience navigating AHJ and utility requirementsTrack record managing interdepartmentally to meet and exceed key operational and customer experience KPIsExcellent organizational skills and ability to prioritizeExcellent analytical skillsEmployment is contingent upon the successful completion of a background check.Equal Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.Process ImprovementOperations ManagementAnalytical SkillsCustomer Relationship Management (CRM)LeadershipRecords ManagementCross-functional Team LeadershipProject ManagementKey Performance IndicatorsOrganization SkillsLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3482565142?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=HJ1Ru0BpTWqZzYjr2ziTiQ%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Palmetto | PalmettoSign in with LinkedInOperations Strategy Manager, ServicesPalmetto United States (Remote)Posted 2 weeks agoFull-timeCustomer ServiceIT Services and IT ConsultingRenewable Energy Semiconductor ManufacturingApplyMeet the hiring teamThelma Patricia PayneTalent Partner | Sr. Recruiter | Passionate About Clean Energy ☀️ & Diversity! 🌈Job PosterAbout the jobCompany DescriptionRecognized by Forbes as one of the fastest-growing private companies in the United States, Palmetto believes that choosing to source clean energy from renewable resources like solar power should be a right, not a privilege. As such, we connect homeowners with renewable energy options such as solar power and energy storage systems. Through our marketplace business model, we empower solar sales professionals and solar installation companies with access to our proprietary design platform, financing, customer management system, logistics, and project management. Our #1 focus is a phenomenal experience for our customers and partners, evidenced in our industry-leading Net Promoter Score.Our employees are our most valuable resource. Palmetto is a VC-backed high-growth company with a promote-from-within culture for talent development. We offer excellent benefits such as unlimited vacation/PTO, medical, dental, and vision coverage, parental leave, and retirement plans.We are a remote-first company and are proud to have great people working for us all over the United States.Summary of RoleThe Services Operations Strategy Manager will help oversee a number of high-priority initiatives across the Services & New Hardware division, which oversees the ongoing service and support needs throughout the 25+ year lifespan of the solar system and the new hardware products we plan to add to our energy ecosystem. You will own projects and processes that drive important operational, financial, and organizational outcomes for Services & New Hardware.Comfort with ambiguity is essential, as you will need to engage in a variety of projects and distill complex topics into simple, actionable insights. This role requires strong business acumen and operational intuition. Building strong relationships is critical to your success, as you’ll need to engage with a broad set of internal and external partners.Strategic & TacticalProject manage short-term and long-term special projects, working across internal and external teams to achieve desired outcomesDesign and manage scrappy pilots on short timeframes across Services & New Hardware to quickly iterate and learn about new operational processes, hardware devices, etc.Build close relationships with and act as the liaison for external stakeholders, including Omnidian (Service Partner), SolarEdge, and EnphaseAnalyze process efficiency and create / update SOPsDeep dive on analytical problems, synthesize data, and deliver insights and recommendationsOversee warranty programs, and dig deep into potential areas where we are foregoing reimbursementsUncover opportunities for improvement in operating/financial performance or customer experience, and support pilot initiatives that drive improvementIncubate other special projects as neededQualificationsBS/BA4+ years of work experience in management/strategy consulting, corporate strategy, business operations, or similar analytical settingHighly collaborative, with experience working across operations, finance, analytics, product, and technology teamsExecutive presence, high degree of professional maturity (comfortable presenting to senior audiences), and strong communication skillsStrong critical thinking and analytical skills (experience modeling in excel required), and a bias for solving problemsProcess-minded, with the ability to create structure in ambiguous, fast-moving environmentsStrong organizational skills, attention to detail, and ability to prioritizeAbility to drive multiple pieces of work forward simultaneouslyPreviously worked at an organization, or within a business unit, that experienced significant growth. Comfortable operating in an environment that is lean and fast-moving. Must have the ability to wear multiple hats and the ability to adjust processes/systems as the company scalesSome experience in technology product management, product operations, or supply chain – especially with hardware tech – is a plusEmployment is contingent upon the successful completion of a background check.Equal Employment OpportunityPalmetto embraces diversity and is an Equal Employment Opportunity employer. Employment is decided on the basis of qualifications, merit, and business need. We do not discriminate based upon race, religion, color, national origin, gender, sexual orientation, gender identity, gender expression, age, status as a protected veteran, status as an individual with a disability, or any other status protected under federal, state, or local law.For more about our Privacy Policy, visit: https://palmetto.com/privacy-policyShow more Top skills for this roleBuild these skills listed on the job description or by the job poster.Cross-team CollaborationProject ManagementStandard Operating Procedure (SOP)Organization SkillsOperational StrategyCustomer ExperienceAnalytical SkillsStrategyProblem SolvingMicrosoft ExcelFeatured benefitsEmployer-providedMedical insurance, dental insurance, vision insurance, paid maternity leave, paid paternity leave, student loan assistance, tuition assistance, and disability insuranceLinkedIn© 2023AboutAccessibilityUser AgreementPrivacy PolicyCookie PolicyCopyright PolicyBrand PolicyGuest ControlsCommunity GuidelinesLanguage | https://www.linkedin.com/enterprise-jobs/3504270900?refId=JOB_SEARCH_JOB_CARD_CLICK%3A%3Ajobs_list_link%3A%3Add07ae90-b921-4516-a6dd-9b46dcc3c74a&trackingId=A%2F0Q1GxMyBsBf2L4sWeX+g%3D%3D&trk=jobs_list_link&utm_source=ArcTern+Ventures+job+board&utm_medium=getro.com&gh_src=ArcTern+Ventures+job+board |
| Android DeveloperFounded in 1994, Mindex is a software development company with a rich history of demonstrated software and product development success. Our three divisions – Cloud, SchoolTool, and Software Development – are all rapidly growing, and our employee base is close to 400. We are ranked the Best Software Developer in the RBJ’s 2022 Reader Rankings, the #1 Software Developer in the 2022 RBJ’s Book of Lists, and a 2022 Certified Great Place to Work.Mindex’s Software Development division is the go-to software developer for enterprise organizations looking to engage teams of skilled technical resources to help them plan, management, requirements planning, design, architecture, development, testing, and support navigate, and execute through the full software product lifecycle, including project.We seek an Android Developer to add to our talented team.Duties and ResponsibilitiesConceptualize and formulate apps suitable for use on all types of Android devicesImplement measures to safeguard users dataEnsure that the construction and presentation of the apps are congruent with the company’s standardsProofread your code and correct mistakes before each app is releasedCollaborate with UI and UX Designers, as well as Software Testers, to ensure that each app is presentable and in perfect working orderLiaison with the marketing department to ensure consistency in our company’s ‘voice’ across the boardMonitor app reviews to detect areas for improvementCreate app updates, including bug fixes and additional features, for release.RequirementsProficiency in Java, Kotlin, or C++Ability to use the Android Studio, including the Android SDK, with easePossess at least one published, original Android appExperience working with remote data via REST and JSONExperience with third-party libraries and APIsWorking knowledge of the general mobile landscape, architectures, trends, and emerging technologiesSolid understanding of the full mobile development life cycleBenefitsHealth insurancePaid holidaysPaid time off401k retirement savings plan and company match with pre-tax and ROTH optionsDental insuranceVision insuranceEmployer paid disability insuranceLife insurance and AD&D insuranceEmployee assistance programFlexible spending accountsHealth savings account with employer contributionsAccident, critical illness, hospital indemnity, and legal assistanceAdoption assistanceDomestic partner coverageMindex PerksTickets to local sporting eventsTeambuilding eventsHoliday and celebration partiesProfessional DevelopmentLicense to Udemy online training coursesLeadership trainingGrowth opportunities | https://remotive.com/remote-jobs/software-dev/android-developer-1629922 |
| Tava Health | Business Development Representative (Remote)Tampa, Florida, United StatesSalesFull timeOVERVIEWAPPLICATIONShare this job DescriptionTava Health is a venture-backed telemedicine startup that partners with employers to provide convenient, high-quality mental health care to employees and their families. At less than three years old, Tava has already partnered with dozens of forward-thinking employers and recently announced a $10M Series A.We are looking for a Business Development Representative to join our team. As a BDR, you will be responsible for identifying potential Tava customers, generating new business opportunities, and managing leads through the sales pipeline. You will work closely with the Director of Partnership team to ensure that our pipeline is developed and our sales goals are met. The person we hire must have excellent communication skills, a strong work ethic, and a proven track record of success in sales. If you are a self-motivated, self-starting individual with a passion for sales, we encourage you to apply.ResponsibilitiesIdentify potential customers and generate new business opportunities for the companyContact and qualify potential customersSet appointments and follow up on leadsTrack progress towards meeting sales goalsCollaborate with the sales team to develop strategies for reaching sales targetsUse customer relationship management (CRM) software to manage leads and sales activitiesRequirements2-3 years of experience in sales or customer serviceProficiency in customer relationship management (CRM) softwareStrong verbal and written communication skillsKnowledge of sales techniques and strategiesTime management and organizational skillsAbility to work independently and as part of a teamBenefitsWhy you’ll enjoy working with us:Enjoy working remotely (anywhere in the contiguous 48 US states) in this full-time, salaried position. Tava offers a highly competitive benefits package including parental leave, plenty of paid holidays and PTO, medical, dental, and vision insurance, and (of course) a generous mental health benefit. This position also offers the opportunity for stock options and commission.Tava is an Equal Opportunity Employer. All applicants will be considered for employment without attention to race, color, religion, sex, sexual orientation, gender identity, national origin, veteran, marital or disability status.As a recruiting team, we do our best to communicate with all candidates. If you have not received an email from Tava within a few days of submitting your application please check your spam filter.***Please note: All Tava hiring is handled by company representatives using “@tavahealth.com” email addresses. Please beware of unauthorized recruiting communications requesting personal information. We never hire anyone without first completing a real-time, face-to-face interview (conducted by video or in-person), nor do we use encrypted instant messaging services like Signal. If you have questions regarding the authenticity of any outreach, please do not hesitate to use the chat feature on our website or contact us at [email protected]***#LI-RemoteApply for this jobTava Health does not discriminate on the basis of race, sex, color, religion, age, national origin, marital status, disability, veteran status, genetic information, sexual orientation, gender identity or any other reason prohibited by law in provision of employment opportunities and benefits.View websiteView all jobsHelpAccessibilityPowered byWorkable | https://apply.workable.com/tava-health/j/A076C4608A?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Senior Director, Product Strategy EngagementPager delivers a “doctor in your family” healthcare experience by making it simple for consumers to connect with the trusted experts they need to make the right healthcare decisions. Through AI-enabled technology, Pager brings consumers, nurses, doctors and other members of the care team together through secure chat, voice and video chat, all in one place. We partner with healthcare organizations to deliver seamless, tech-enabled services and solutions for a consumer experience that leads to better decisions, outcomes and healthier lives. Started in 2014 and based in New York City, Pager is led by seasoned technology and healthcare entrepreneurs to redefine the way that consumers interact with their healthcare.Pager is looking for a passionate health / healthcare leader to assist in the build out and expand our health & well-being product engagement experience. This person must be a hands-on leader who has deep experience serving as the voice of the customer to deliver true value to our members.This position will have a critical voice in our digital health & well-being platform strategy within the product organization, including areas like member / patient engagement, desktop and mobile user experience, interoperability, reporting and analytics, personalization, engagement marketing, and incentive design.The primary focus of this role will be on the early stages of the member / patient journey: driving awareness, adoption, engagement, outcomes, and creating valued and sustained member relationships. To be successful, this team member will build working relationships across the organization, including with client services, sales, technology, operations, marketing, and customer service. This role will also collaborate closely with clients and external partners, convening the expertise and talents necessary to plan, execute, and manage successful engagement projects.Our ideal candidate will also be entrepreneurial, curious, innovative, politely push the status quo, and always rally the organization to create customer-centered experiences that engage and provide value for our members.In this role you will drive our engagement strategy. You will partner with Product Management to develop capabilities and sit with clients and client success to strategize on driving impact. To be successful, this leader must bring a passion for payer-oriented well-being and deep experience in B2C engagement marketing. The core however is Product Strategy and this role will be instrumental to develop multiple aspects of our health & well-being platform to make it more appealing to consumers. The Senior Director plays a key role in helping to translate market needs into investment ideas while overseeing subsequent analysis, business case creation, prioritization, planning, development, and go-to-market activity.We have a highly collaborative culture and this role partners very closely with Sales, Client Success, Clients, Operations, Informatics, and Technology. We need you to be creative, have an ability to see opportunities in complex problems, have ideas on how to fix healthcare, and help stakeholders; so they can be brought along. A rewarding element of this role is developing capabilities that get people to the help they need to live healthier lives.Responsibilities:• Ensure our well-being product line is perceived as the market leader in its domain• Manage and sustain a best-in-class engagement levels• Ensure solutions deliver effectiveness, efficiency, superlative experiences, and innovation.• Ensure external and internal stakeholders understand the our products and value proposition contextually• Increase revenue opportunities through growth in features, use cases, and markets for product verticals• Increase company brand valueQualifications:Related Bachelor’s Degree or additional related equivalent work experience10+ years of of related product management, marketing, or related work experience5+ years of direct supervisory/management experienceDemonstrated consumer healthcare market understanding/knowledge requiredDemonstrated experience developing strategies, developing capabilities and guiding clientsPast experience in Agile/Scrum methodologyDirect client interfacing and relationship management experiencePast experience with financial modelingStrong written and verbal communication skillsFor Colorado, Nevada, and New York-based employment: In accordance with the Pay Transparency laws the pay range for this position is $155,000 to $185,000. The compensation package may include stock options, plus a range of medical, dental, vision, financial, generous PTO, stipends for professional development, and wellness benefits. Final compensation for this role will be determined by various factors such as a candidate’s relevant work experience, skills, certifications, and geographic location. The range listed only applies to Colorado, Nevada, and New York.At Pager, we value diversity and always treat all employees and job applicants based on merit, qualifications, competence, and talent. We do not discriminate on the basis of race, religion, color, national origin, gender, sexual orientation, age, marital status, veteran status, or disability status. | https://remotive.com/remote-jobs/marketing/senior-director-product-strategy-engagement-1621960 |
| Huntress | Apply NowSoftware Engineering Manager, Process Insights (MEDR)at Huntress (View all jobs)Remote US and CanadaReports to: Senior Director of EngineeringLocation: Remote, US and Canada OnlyCompensation Range: $140,000 to $190,000 plus bonus and equityWhat We Do: Founded in 2015 by former NSA cyber operators, Huntress was built on a simple premise: to force hackers to earn every inch of their access.Today’s cyber-attacks aren’t limited to large organizations with the security tools that can ward off threats. Hackers don’t discriminate and will find a way to penetrate any vulnerability in any size business. Huntress enables IT providers and resellers to stop hidden threats that sneak past preventive security tools.Through a combination of expert human threat hunters, a comprehensive platform, and a desire to make the world a safer place, we’re working to deliver cybersecurity to the 99%—those small to midsize businesses that make up the backbone of our economy. Join the hunt and help us stop hackers in their tracks!What You’ll Do:You’ll lead an engineering team that builds and supports our flagship product, Process Insights (MEDR). You’ll work closely with the team’s product manager, designer, and cybersecurity expert to design, build, validate, and support both agent and web-based applications. You’ll grow and develop a team of smart and diverse problem solvers who are innovative, skilled, and passionate about delivering for our customers. As part of the engineering leadership team, you’ll help develop better ways for us to work. At Huntress, we work with low walls between disciplines because we believe good ideas are everywhere and the best products come from teams who work together to deeply understand our customers, experiment, and validate our products. Who You Are:You’ve been a software engineer and understand modern cloud-based architectures. You don’t need to code anymore to have fun at work, but you’re able to think both tactically and strategically about a solution and the right way to build it. You enjoy thinking about products as well as engineering and have a track record developing and iterating on SaaS products. You have managed technical teams and know how to coach and develop both individuals and a team.Responsibilities:Deliver awesome products for our customers that are maintainable, reliable, and resilient Recruit, hire, coach, and mentor a diverse team of engineers who are technically skilled, collaborative, and creativeIdentify and remove impediments for your teamContinuously improve your team’s performance and healthLead with transparency, candidly challenge assumptions, exhibit integrity above all else What You Bring To The Team3+ years experience in engineering leadership building SaaS products in a modern SaaS environmentSkilled at hiring, building teams, leading and coaching managers, and performance managementExperience with different software development methodologies such as plan-build-ship, scrum, and kanbanExcellent technical, diagnostic, and troubleshooting skillsAbility to grasp new software architecture and technology quicklyAbility to build strong interpersonal relationships with product, development teams, leadership, senior management, and internal and external stakeholders to help minimize silos and drive teamwork across teamsExperience with Ruby on Rails development is not required, but extremely beneficialWhat We Offer: 100% remote work environment – since our founding in 2015Generous paid time off policy including vacation, sick time, and paid holidays12 weeks paid parental leaveHighly competitive and comprehensive medical, dental, and vision benefits plans 401(k) with 5% contribution regardless of employee contributionLife and Disability insurance plansStock options for all full-time employees One-time $500 stipend to build/upgrade home officeAnnual allowance for education and professional development assistance $75 USD/month digital reimbursementAccess to both Udemy and BetterUp platforms for coaching, personal, and professional growthHuntress is committed to creating a culture of inclusivity where every single member of our team is valued, has a voice, and is empowered to show up to work every day as their full self. We do not discriminate based on race, ethnicity, color, ancestry, national origin, religion, sex, sexual orientation, gender identity, disability, veteran status, genetic information, marital status or any other legally protected status. We do discriminate against hackers who try to exploit small businesses.Accommodations:If you require reasonable accommodation in completing this application, interviewing, completing any pre-employment testing, or otherwise participating in the employee selection process, please direct your inquiries to [email protected]. Please note non-accommodation requests to this inbox will not receive a response. If you have any questions about your personal data privacy at Huntress, please visit our privacy page.#BI-RemoteApply for this Job* RequiredFirst Name *Last Name *Email *Phone *Location (City) * Locate me Resume/CV *Attach Dropbox Google Drive or enter manually(File types: pdf, doc, docx, txt, rtf)Cover LetterAttach Dropbox Google Drive or enter manually(File types: pdf, doc, docx, txt, rtf)Will you now or in the future require sponsorship for employment visa status? (e.g. H-1B, E-3, TN status) *–Are you authorized to work for any employer in the United States? *–If applicable, please share a link to your professional website, portfolio, Github account or similar site herePlease provide LinkedIn profileWere you referred to Huntress by one of our employees? If so, whom?How did you hear about Huntress? Company page, job posting, event, somewhere else?Voluntary Self-IdentificationFor government reporting purposes, we ask candidates to respond to the below self-identification survey. Completion of the form is entirely voluntary. Whatever your decision, it will not be considered in the hiring process or thereafter. Any information that you do provide will be recorded and maintained in a confidential file.As set forth in Huntress’s Equal Employment Opportunity policy, we do not discriminate on the basis of any protected group status under any applicable law.GenderPlease selectGenderAre you Hispanic/Latino?Please selectAre you Hispanic/Latino?Race & Ethnicity DefinitionsIf you believe you belong to any of the categories of protected veterans listed below, please indicate by making the appropriate selection. As a government contractor subject to the Vietnam Era Veterans Readjustment Assistance Act (VEVRAA), we request this information in order to measure the effectiveness of the outreach and positive recruitment efforts we undertake pursuant to VEVRAA. Classification of protected categories is as follows:A “disabled veteran” is one of the following: a veteran of the U.S. military, ground, naval or air service who is entitled to compensation (or who but for the receipt of military retired pay would be entitled to compensation) under laws administered by the Secretary of Veterans Affairs; or a person who was discharged or released from active duty because of a service-connected disability.A “recently separated veteran” means any veteran during the three-year period beginning on the date of such veteran’s discharge or release from active duty in the U.S. military, ground, naval, or air service.An “active duty wartime or campaign badge veteran” means a veteran who served on active duty in the U.S. military, ground, naval or air service during a war, or in a campaign or expedition for which a campaign badge has been authorized under the laws administered by the Department of Defense.An “Armed forces service medal veteran” means a veteran who, while serving on active duty in the U.S. military, ground, naval or air service, participated in a United States military operation for which an Armed Forces service medal was awarded pursuant to Executive Order 12985.Veteran StatusPlease selectVeteran StatusForm CC-305OMB Control Number 1250-0005Expires 05/31/2023Voluntary Self-Identification of DisabilityWhy are you being asked to complete this form?We are a federal contractor or subcontractor required by law to provide equal employment opportunity to qualified people with disabilities. We are also required to measure our progress toward having at least 7% of our workforce be individuals with disabilities. To do this, we must ask applicants and employees if they have a disability or have ever had a disability. Because a person may become disabled at any time, we ask all of our employees to update their information at least every five years.Identifying yourself as an individual with a disability is voluntary, and we hope that you will choose to do so. Your answer will be maintained confidentially and not be seen by selecting officials or anyone else involved in making personnel decisions. Completing the form will not negatively impact you in any way, regardless of whether you have self-identified in the past. For more information about this form or the equal employment obligations of federal contractors under Section 503 of the Rehabilitation Act, visit the U.S. Department of Labor’s Office of Federal Contract Compliance Programs (OFCCP) website at www.dol.gov/ofccp.How do you know if you have a disability?You are considered to have a disability if you have a physical or mental impairment or medical condition that substantially limits a major life activity, or if you have a history or record of such an impairment or medical condition.Disabilities include, but are not limited to:AutismAutoimmune disorder, for example, lupus, fibromyalgia, rheumatoid arthritis, or HIV/AIDSBlind or low visionCancerCardiovascular or heart diseaseCeliac diseaseCerebral palsyDeaf or hard of hearingDepression or anxietyDiabetesEpilepsyGastrointestinal disorders, for example, Crohn’s Disease, or irritable bowel syndromeIntellectual disabilityMissing limbs or partially missing limbsNervous system condition for example, migraine headaches, Parkinson’s disease, or Multiple sclerosis (MS)Psychiatric condition, for example, bipolar disorder, schizophrenia, PTSD, or major depressionDisability StatusPlease selectDisability StatusPUBLIC BURDEN STATEMENT: According to the Paperwork Reduction Act of 1995 no persons are required to respond to a collection of information unless such collection displays a valid OMB control number. This survey should take about 5 minutes to complete.Powered by Read our Privacy Policy | https://boards.greenhouse.io/huntress/jobs/5540689003?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Huntress | Apply NowBusiness Development Representativeat Huntress (View all jobs)Remote USReports to: BDR ManagerLocation: RemoteCompensation: $50,000 base salary with on-target earnings of $65,000, plus equityWhat We Do: Founded in 2015 by former NSA cyber operators, Huntress was built on a simple premise: to force hackers to earn every inch of their access.Today’s cyber-attacks aren’t limited to large organizations with the security tools that can ward off threats. Hackers don’t discriminate and will find a way to penetrate any vulnerability in any size business. Huntress enables IT providers and resellers to stop hidden threats that sneak past preventive security tools.Through a combination of expert human threat hunters, a comprehensive platform, and a desire to make the world a safer place, we’re working to deliver cybersecurity to the 99%—those small to midsize businesses that make up the backbone of our economy. Join the hunt and help us stop hackers in their tracks!What You’ll Do: Huntress is seeking to add a Business Development Representative to join our highly collaborative team. In this role, you will be responsible for reaching out to potential partners who have expressed an interest in Huntress. You will connect with them via phone and email to qualify and provide them with basic information about our products.As a Business Development Representative (BDR) with Huntress, you’ll work closely with management, our SDR (Sales Development) team, and our Account Executive team to share high-quality, highly engaged leads. You will work to hit your weekly goals and maintain Quality Assurance, all while demonstrating a commitment to growth within your role and on the team.Responsibilities:Achieve metrics by following processes and using multiple communication tools, including phone, email, and LinkedIn.Use a best-practices approach to meet all inbound leads with prompt outreach highlighting our commitment to customer support and partnerships.Answer all questions with honesty, professionalism, and empathy.Build rapport and trust with potential partners by actively listening to their needs, making recommendations, and providing insight into the Huntress platform.Use standard qualification processes to confirm our ICP (Ideal Customer Profile) is satisfied and that our value proposition is understood.Schedule quality sales appointments with the appropriate Account Executives.Thoroughly document all interactions and prospecting efforts in our CRM (Customer Relationship Management tool) while maintaining good data hygiene.Regularly attend sessions promoting continuous growth and learning presented by the company on messaging tactics, pipeline management, and conversation skills.Regularly communicate and collaborate with peers and management.What You Bring To The Team:Enjoy working collaboratively to achieve individual, team, and company goals.Enjoy working in a fast-paced environment at a high-growth organization.Comfortable navigating multiple platforms and systems simultaneously.Genuinely care about helping customers and potential customers.Team player demonstrating a team-before-self mindset.Empathetic and thoughtful communicator.Ability to pay close attention to detail when taking notes, setting appointments, and following processes.Coachable and eager to continue to expand your knowledge of sales and cybersecurity, maintaining a growth mindset. Self-motivated, able to work independently, asking for help early and as needed.Experience using a CRM (Customer Relationship Management) system like Hubspot or Salesforce.What We Offer: 100% remote work environment – since our founding in 2015Generous paid time off policy including vacation, sick time, and paid holidays12 weeks paid parental leaveHighly competitive and comprehensive medical, dental, and vision benefits plans 401(k) with 5% contribution regardless of employee contributionLife and Disability insurance plansStock options for all full-time employees One-time $500 stipend to build/upgrade home officeAnnual allowance for education and professional development assistance $75 USD/month digital reimbursementAccess to both Udemy and BetterUp platforms for coaching, personal, and professional growthHuntress is committed to creating a culture of inclusivity where every single member of our team is valued, has a voice, and is empowered to show up to work every day as their full self. We do not discriminate based on race, ethnicity, color, ancestry, national origin, religion, sex, sexual orientation, gender identity, disability, veteran status, genetic information, marital status or any other legally protected status. We do discriminate against hackers who try to exploit small businesses.Accommodations:If you require reasonable accommodation in completing this application, interviewing, completing any pre-employment testing, or otherwise participating in the employee selection process, please direct your inquiries to [email protected]. Please note non-accommodation requests to this inbox will not receive a response. If you have any questions about your personal data privacy at Huntress, please visit our privacy page.#BI-Remote Apply for this Job* RequiredFirst Name *Last Name *Email *Phone *Location (City) * Locate me Resume/CV *Attach Dropbox Google Drive or enter manually(File types: pdf, doc, docx, txt, rtf)Cover LetterAttach Dropbox Google Drive or enter manually(File types: pdf, doc, docx, txt, rtf)Will you now or in the future require sponsorship for employment visa status? (e.g. H-1B, E-3, TN status) *–Are you authorized to work for any employer in the United States? *–If applicable, please share a link to your professional website, portfolio, Github account or similar site herePlease provide LinkedIn profileWere you referred to Huntress by one of our employees? If so, whom?How did you hear about Huntress? Company page, job posting, event, somewhere else?Voluntary Self-IdentificationFor government reporting purposes, we ask candidates to respond to the below self-identification survey. Completion of the form is entirely voluntary. Whatever your decision, it will not be considered in the hiring process or thereafter. Any information that you do provide will be recorded and maintained in a confidential file.As set forth in Huntress’s Equal Employment Opportunity policy, we do not discriminate on the basis of any protected group status under any applicable law.GenderPlease selectGenderAre you Hispanic/Latino?Please selectAre you Hispanic/Latino?Race & Ethnicity DefinitionsIf you believe you belong to any of the categories of protected veterans listed below, please indicate by making the appropriate selection. As a government contractor subject to the Vietnam Era Veterans Readjustment Assistance Act (VEVRAA), we request this information in order to measure the effectiveness of the outreach and positive recruitment efforts we undertake pursuant to VEVRAA. Classification of protected categories is as follows:A “disabled veteran” is one of the following: a veteran of the U.S. military, ground, naval or air service who is entitled to compensation (or who but for the receipt of military retired pay would be entitled to compensation) under laws administered by the Secretary of Veterans Affairs; or a person who was discharged or released from active duty because of a service-connected disability.A “recently separated veteran” means any veteran during the three-year period beginning on the date of such veteran’s discharge or release from active duty in the U.S. military, ground, naval, or air service.An “active duty wartime or campaign badge veteran” means a veteran who served on active duty in the U.S. military, ground, naval or air service during a war, or in a campaign or expedition for which a campaign badge has been authorized under the laws administered by the Department of Defense.An “Armed forces service medal veteran” means a veteran who, while serving on active duty in the U.S. military, ground, naval or air service, participated in a United States military operation for which an Armed Forces service medal was awarded pursuant to Executive Order 12985.Veteran StatusPlease selectVeteran StatusForm CC-305OMB Control Number 1250-0005Expires 05/31/2023Voluntary Self-Identification of DisabilityWhy are you being asked to complete this form?We are a federal contractor or subcontractor required by law to provide equal employment opportunity to qualified people with disabilities. We are also required to measure our progress toward having at least 7% of our workforce be individuals with disabilities. To do this, we must ask applicants and employees if they have a disability or have ever had a disability. Because a person may become disabled at any time, we ask all of our employees to update their information at least every five years.Identifying yourself as an individual with a disability is voluntary, and we hope that you will choose to do so. Your answer will be maintained confidentially and not be seen by selecting officials or anyone else involved in making personnel decisions. Completing the form will not negatively impact you in any way, regardless of whether you have self-identified in the past. For more information about this form or the equal employment obligations of federal contractors under Section 503 of the Rehabilitation Act, visit the U.S. Department of Labor’s Office of Federal Contract Compliance Programs (OFCCP) website at www.dol.gov/ofccp.How do you know if you have a disability?You are considered to have a disability if you have a physical or mental impairment or medical condition that substantially limits a major life activity, or if you have a history or record of such an impairment or medical condition.Disabilities include, but are not limited to:AutismAutoimmune disorder, for example, lupus, fibromyalgia, rheumatoid arthritis, or HIV/AIDSBlind or low visionCancerCardiovascular or heart diseaseCeliac diseaseCerebral palsyDeaf or hard of hearingDepression or anxietyDiabetesEpilepsyGastrointestinal disorders, for example, Crohn’s Disease, or irritable bowel syndromeIntellectual disabilityMissing limbs or partially missing limbsNervous system condition for example, migraine headaches, Parkinson’s disease, or Multiple sclerosis (MS)Psychiatric condition, for example, bipolar disorder, schizophrenia, PTSD, or major depressionDisability StatusPlease selectDisability StatusPUBLIC BURDEN STATEMENT: According to the Paperwork Reduction Act of 1995 no persons are required to respond to a collection of information unless such collection displays a valid OMB control number. This survey should take about 5 minutes to complete.Powered by Read our Privacy Policy | https://boards.greenhouse.io/huntress/jobs/5531057003?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Mercy for Animals | Solicita empleoCoordinador(a) de Voluntariado, Méxicoen Mercy For AnimalsRemoto, MéxicoMercy For Animals existe para ponerle fin a la explotación de animales como alimento mediante la creación de un sistema alimentario justo y sostenible. Nuestra visión es crear un mundo en el que los animales sean respetados, protegidos y libres.Como organización líder en defensa de los animales confinados en granjas, sabemos que lograr este objetivo requiere un entorno de trabajo diverso, incluyente y colaborativo, que acoja y genere nuevas perspectivas e ideas innovadoras. Si te apasiona nuestra misión, si te motiva generar un impacto en los animales y quisieras ser parte de un grupo de personas comprometidas, ¡únete a nuestro equipo! Actualmente buscamos un(a) coordinador(a) de voluntariado para que se una a Mercy For Animals.. Desempeñarás un papel de alto impacto y de misión crítica, apoyando el crecimiento del programa de voluntariado en México y aumentando la capacidad de su equipo. Esto incluye el reclutamiento y el contacto constante con el voluntariado, la planeación de acciones y eventos y el desarrollo y la optimización de herramientas de comunicación y de materiales para el voluntariado..Realizarás un trabajo invaluable:Trabajando de cerca con el Gerente de Voluntariado de Mercy For Animals, México para aumentar la capacidad de acción del departamento mediante reclutamiento, involucramiento y desarrollo, así como fortaleciendo la infraestructura del programa y coordinando tareas con otros departamentos en diversos proyectos;Coordinando, supervisando la logística y dando seguimiento a los eventos de voluntariado, lo cual incluye acciones y protestas, eventos de participación pública, reuniones de convivencia para acrecentar la comunidad e impulsando las campañas de Mercy For Animals;Gestionando y optimizando los sistemas de comunicación masiva del voluntariado, como las bases de datos, los servidores de listas de correo electrónico y los grupos de WhatsApp;Creando, gestionando y optimizando sistemas eficientes de organización, registro, logística, comunicación e inventario;Involucrándote activamente en el reclutamiento, la inducción, la capacitación, el seguimiento y la comunicación constante con el voluntariado y los roles de liderazgo, además de impulsar la formación y el crecimiento de comunidades en distintas ciudades del país;Estableciendo y cultivando relaciones con otras organizaciones y campañas adicionales a aquéllas con líderes de voluntariado;Inspirando al voluntariado mediante un ejemplo de liderazgo en el activismo presencial y en línea;Adheriéndote a todas las políticas de recursos humanos y procedimientos organizacionales;Realizando cualquier otra tarea asignada por la supervisión. Tus habilidades llevarán a nuestro equipo al siguiente nivel:Mínimo un año de experiencia coordinando y liderando voluntariado, preferiblemente en el movimiento de los derechos de los animales;Estudios de preparatoria completados (preferentemente carrera técnica o licenciatura);Pensamiento estratégico y analítico, capacidad para solucionar problemas, disposición a recibir retroalimentación, inclinación por el aprendizaje continuo y el mejoramiento profesional;Familiaridad con o interés por distintos modelos de voluntariado;Familiaridad con el manejo digital de voluntariado (preferible);Familiaridad con herramientas digitales (correo electrónico, herramientas de gestión de proyectos);Capacidad para organizar y gestionar múltiples proyectos de manera simultánea para cumplir con las fechas establecidas; Atención al detalle;Apoyo a la filosofía y a la teoría del cambio que sigue Mercy For Animals, además de capacidad de defender las posturas de la organización de manera profesional;Excelente comunicación escrita y oral (la experiencia de hablar en público es preferible);Habilidad para relacionarse, socializar y fuertes habilidades interpersonales;Habilidad para trabajar en equipo;Nivel de inglés básico (preferentemente intermedio).Disponibilidad para viajar cuando se requiera;Compromiso con la misión, los valores y los objetivos de la organización;Compromiso y apertura para el crecimiento personal y organizacional continuo en materia de diversidad, equidad, inclusión y justicia; Acerca de tu líder de equipoTu líder de equipo, Felipe (él), es nuestro Gerente de Voluntariado. Se encarga de planificar, liderar y ejecutar el Programa Nacional de Voluntariado de Mercy For Animals regional mediante la creación de comunidades de voluntarios comprometidos y líderes comunitarios que contribuyan a la misión de crear un mundo donde los animales sean respetados, protegidos y libres de perseguir sus propios intereses.A Felipe lo inspira generar y aumentar el poder social en comunidades que empujen de manera positiva hacia mejoras sistémicas. Valora la colaboración, la comunicación honesta, bien intencionada y directa, y la innovación de ideas y estrategias. Felipe cree en generar auténticos vínculos de trabajo colaborativo y alianzas dentro del movimiento como condición indispensable para alcanzar el éxito de la liberación animal. Él busca el desarrollo de activistas como líderes que expandan sus capacidades, sus redes comunitarias y sus campos de acción como una estrategia indispensable hacia la liberación animal, de tal forma que el desarrollo de activistas y de las comunidades animalistas están estrechamente ligadas con el desarrollo del movimiento animalista. Compensación y beneficiosRecibirás un salario mensual bruto (antes de impuestos) entre $16,000.00 MXN – $20,000.00 MXN , dependiendo de tus habilidades y experiencia. Además de un entorno de trabajo colaborativo e innovador, contarás con nuestro paquete de beneficios*, el cual incluye una generosa política de tiempo remunerado que incluye 15 días de vacaciones y hasta 7 días de enfermedad, así como vales de despensa, seguro de gastos médicos mayores particular, bono de oficina remota y bono de bienestar y desarrollo profesional.*Sujeto a un periodo de prueba de 6 meses. Detalles de la postulaciónConsideramos las habilidades tradicionales y no tradicionales y revisamos cuidadosamente cada solicitud, currículum y carta de presentación. Siéntete libre de expresarte a tu manera y de salir de lo tradicional en tu carta de presentación. Nos encantará saber qué puedes sumar a nuestra cultura y qué quisieras aportar al equipo, así como tu alineación general con nuestra visión, misión y valores organizacionales. Nuestro compromiso contigoMercy For Animals es una organización con una mentalidad global, y valoramos diversas perspectivas y orígenes. Tenemos un compromiso sólido con los principios de equidad y justicia, y nuestra cultura celebra la autenticidad, lo que permite que cada miembro del equipo brille a su manera. Todas las decisiones de empleo se basan únicamente en las competencias individuales, las necesidades laborales y los requisitos laborales, y se alienta a posibles miembros del equipo de cualquier color, orientación, edad, sexo, identidad y expresión de género, origen y capacidad a presentar su postulación. Nos comprometemos a proporcionar un ambiente de trabajo inclusivo, positivo, respetuoso, seguro y de apoyo, donde la igualdad de oportunidades esté disponible para todas las personas.Muéstranos como eres y ayúdanos a transformar nuestra sociedad y a construir un sistema alimentario verdaderamente compasivo.Al enviar tu información, indicas que has leído nuestra Política de Privacidad y que aceptas sus términos. Postule a este trabajo* ObligatorioNombre *Apellido *Correo electrónico *Teléfono *Ubicación (Ciudad) * Locate me Currículum *Adjuntar Google Drive Pegar(File types: pdf, doc, docx, txt, rtf)Carta de presentación *Adjuntar Google Drive Pegar(File types: pdf, doc, docx, txt, rtf)What about Mercy For Animals’ mission and vision inspires you? Please answer in English *How do you identify opportunities for improvement in your work? Please answer in English *Describe brevemente una ocasión en la que experimentaste alguna derrota o fracaso en tu trabajo *Describe brevemente una situación en la que requeriste considerar una perspectiva diferente a la tuya para enfrentar un problema *¿Cuál es la mejor idea que has tenido dentro de tu experiencia profesional? *¿Qué aportarías a la cultura de nuestro equipo? *En tu vida diaria, ¿cómo apoyas a la reducción del sufrimiento animal? *¿Cuáles son tus expectativas económicas? *¿En dónde resides actualmente y tienes permiso para laborar en México? *Compártenos una muestra de tu trabajo (máximo 2 MB)Attach File Google Drive(File types: pdf, doc, docx, txt, rtf)Perfil de LinkedInSitio webPowered by Read our Privacy Policy | https://boards.greenhouse.io/mercyforanimals/jobs/4889005 |
| University of California, Center for Long-Term Cybersecurity | Skip to contentCLTCGive to CLTCSearchMenuRESEARCHPrograms & InitiativesResearch LibraryResearch TopicsNEWS & EVENTSNewsEventsMedia ResourcesCLTC Blog(opens in a new tab)GIVE TO CLTCJoin Our Mailing ListPartner on Cybersecurity Futures 2030Give to CLTCABOUTOur ValuesPeopleJobs at CLTCContact UsSupport the future of cybersecurityDonateBerkeley School of Information(opens in a new tab)Berkeley Division of Computing, Data Science & Society(opens in a new tab)Home / News & Events / NewsJob Announcement / March 2023Graduate Student Researcher: Cyber Risk Metrics Development for Board of DirectorsJob Description:The UC Berkeley Center for Long-Term Cybersecurity (CLTC) is seeking a Graduate Student Researcher (GSR) to assist with the identification and classification of cybersecurity metrics in current academic literature and periodic company reports. The GSR will subsequently draft a white paper on cyber risk metrics for boards of directors based on the research findings.The project objective is to develop a systematic overview of the most influential articles and methodologies used in the accounting, information systems, security, law, and governance literature to meet the Securities and Exchange Commission (SEC) and European Securities and Monetary Authority (ESMA) exigences on cyber risk indicators. The findings will then be compared to the current usage of these indicators in the periodic reports of S&P 500 companies.The Graduate Student Researcher will work together with Prof. Laura Schaffner and join ongoing research at CLTC by using a Systematic Literature and Network Analysis (SLNA) methodology, which is based on data gathered from a citation database of choice, such as Web of Science, Google Scholar or Scopus, as well as the latest periodic reports available of S&P 500 companies.The product’s methodology includes the following two steps: SLR – Systematic Literature Review: the first phase consists of determining the scope and limitations of the existing literature, as well as choosing, analyzing, and isolating the most relevant articles for the reasons indicated. BNA – Bibliographic Network Analysis: the second phase includes:CNA – Citation Network Analysis: groups the articles into clusters based on their content, highlighting the ones that have had the most impact on the study field’s progress. The citation flows resulting from the CNA are then partitioned into “paths” (Strozzi et al., 2017), among which the primary or “main” path is determined, based on the assumption that research works in the same area will cite one another. CSA – Citation Score Analysis: detects significant papers that have received a big number of citations throughout time but are not in the above-mentioned citation network, and it can be global (GCSA), global-local (GLCSA) or based on computed indexes; KNA – Keyword Network Analysis: gives evidence with regard to prospective patterns and trends in the study field under examination based on the detection of co-occurrences among author chosen keywords, possibly representing, as a consequence, an adequate proxy of the underlying research topics (Ding, Chowdhury & Foo, 2001; Minutiello & Tettamanzi, 2021). The following five data science tools and techniques will be used to conduct the SLNA: VOSviewer: preliminary test for network visualization and co-occurrence keyword network analysis. Pajek: social network analysis on many citation networks in order to determine the primary or ‘main’ research path(s); Sci2 Tool: temporal, geographic, topical, and network analysis; GIMP: display of before-mentioned findings;Scopus analytics: confirm, integrate, or refute results obtained using the tools listed above. Upon completion of the project, the results will be integrated into a formal model and will be tested in a practice environment applying a Delphi method using interviews and dialogues with non-executive board members. For performing this second phase, the contract may be prolonged for 10 more weeks.This GSR appointment is at 20% (8 hours/week) and does not include fee remission. The student must be available to meet in-person on campus twice a week throughout the semester. Term:Spring Term 2023 (immediately – May 12, 2023, with a possible extension through August depending on the results from this initial phase of the project)Required Qualifications:Actively enrolled in a graduate-level degree program at UC BerkeleyInterest in performing analysis in the fields of cyber risks/security, accounting and disclosure, and AIAbility to synthesize and paraphrase longer texts very (!) conciselyExcellent English writing skillsPreferred Qualifications:Background in cybersecurity, public policy, data science, and/or accountingEnjoy to explore/extant knowledge pertinent to the mentioned topic at higher/ academic/ research levelProficiency in some or all of the following tools: (1) VOSviewer (2) GIMP (3) Pajek (4) Sci2 Tool, and (5) Excel. Supervisor: Laura G. SchaffnerCompensation: Information on GSR salary scales can be found here. The step level for this appointment will be commensurate with experience.Apply:Please prepare a resume and a brief cover note (~250 words) describing your interest in the position and any relevant experience, particularly as it relates to the required and preferred qualifications above. Submit your application using this form.Deadline:First review date: March 20, 2023 at 11:59 PM PTSecond Review Date: March 27, 2023 at 11:59 PM PTQuestions: Please email [email protected] with any questions.ApplyTopics#board governance #riskRelated NewsNews March 7, 2023Response to NIST AI RMF Full Draft Playbook, Roadmap, and CrosswalksEvent Recap February 8, 2023“The Future CISO and the Evolving Role of Digital Risk” with Davis HakeEvent Recap, News December 16, 2022Panel: The Critical Role of Cybersecurity in M&AScroll to the top of the pageHelp build and expand our future-focused research agendaGive to CLTCResearchGive to CLTCNews & EventsAboutResearch LibraryFind a Job or InternshipPartner on Cybersecurity Futures 2030Subscribe to our mailing list 2023 UC Berkeley Center for Long-Term Cybersecurity. All Rights Reserved.Privacy PolicyFunding PolicyAccessibilityNondiscriminationFacebookTwitterYouTubeLinkedInWhat is the purpose of your visit today?Next | https://cltc.berkeley.edu/2023/03/15/gsr-cyber-risk-metrics-development-for-board-of-directors/ |
| GiveDirectly | | https://boards.greenhouse.io/givedirectly/jobs/4221645005 |
| University of Chicago, Booth School of Business | | https://www.chicagobooth.edu/-/media/faculty/research-professional-program/job-ads/2022-23/patterson-rp-ad-v2.pdf |
| CoW Protocol: Integration EngineerHeadquarters: Lisbon, Portugal URL: https://cow.fi/Location: We are a fully remote team, and although we hire globally, there is a preference for this role to be based in Europe or remote +/- 3 hours CEST timePosition: Full-time ContractorAbout the roleYou will be part of the frontend team and closely align and work together with the business development team. The goal for this role is to increase the amount of integrations of CoW Swap and grow the general ecosystem that’s built around CoW Swap. As part of your role you will examine and brainstorm new collaboration ideas with our partners, improve the SDK and general developer experience, work closely on our grants program (define bounties and evaluate submissions), and attend conferences and hackathons.What you’ll doBe CoW Protocol’s foremost expert on the developer audience. Work to understand the core needs, pain points, and motivations of external engineers that are tasked with evaluating and implementing CoW ProtocolStructure documentation requirements for developers with varying objectives — from integrating CoW Protocol into their existing DeFi platforms to creating new solvers for the core protocolDevelop features that foster fast integrations (e.g. easy to integrate widget for swapping)Help the CoW GrantsDAO in creating new technical bounties as well as assessing bounty applications and submissionsPlan, oversee, and develop materials for CoW Protocol’s presence at hackathons. Travel the globe to be an on-hand resource for anywhere between 4-8 Ethereum conferences per yearShape the roadmap of CowSwap by collecting and scoping out new feature requests and proposing improvements that will accelerate the onboarding of new partnersAttend sales calls between technical teams to assess deal potential, suggest other collaborations, and ideas, and evaluate priorities.Maintain excellent communication with current and potential partners in terms of onboarding and ongoing support.Who you areYou have several years of experience developing professional client-side web appsExperience in Python, JS, ReactExperience designing restful APIAutomation of tools, dockerA natural collaborator and problem solverExperience developing software solutionsExtrovert, you enjoy talking to other devs and exploring new ideas for collaborationsExcellent communication skills in EnglishExcited by new challengesProactive & hands-on! Sending code snippets to kick-start an integration can go a long way!It’s a plus if you bring:Understanding of the Ethereum blockchain and ecosystem, general finance and/or game theory, and mechanism design.Good to have other relevant languages, like Rust, C++, SolidityGood to have experience in consulting, on technology solutions or as a client-facing solutions architect, integrations engineer, or similarOur tech stackProduct: Typescript, React, Redux, styled-components, Rust, Python, C++Web3 development: Web3, ethersjs, Hardhat, Foundry, Solidity, IPFS, TheGraph, ENSTesting: jest, cypress, React testing-libraryAnalytic tools: Dune Analytics, Google AnalyticsWhat we can offer youFlexible work environment: join one of our hubs in Berlin or Lisbon or work remotely with the option of joining a local coworking space;Competitive compensation and a stake in the success of the project (token plan);Regular trips to reunite with the rest of the team;Conference budget to keep up to date with the developments of the ecosystem;Learning budget to support your higher ambitions;Impact: If you are joining a startup, and you can make a huge difference. Your work matters!But most importantly – grow with us! We’re growing rapidly, the industry is expanding fast, and we have a lot to do. If you’re someone who loves taking the initiative and getting things done, there are a lot of opportunities for you at CoW Protocol. We’re enthusiastic about our shared mission and enjoy spending time together!CultureLife in CoW Protocol is an amazing journey, we pride ourselves on how we work together. We like autonomy, we think big, and we have a growth mindset. We value initiatives and ownership. Our work is open source, designed code is publicly accessible – anyone can see, modify, and distribute the code as they see fit.Research shows that while men apply to jobs when they meet an average of 60% of the criteria, women and other folks tend to only apply when they check every box. If you think you have what it takes but don’t necessarily meet every single point on the job description, please still get in touch. We would love to hear from you.We look forward to your application!To apply: https://weworkremotely.com/remote-jobs/cow-protocol-integration-engineer | https://weworkremotely.com/remote-jobs/cow-protocol-integration-engineer |
| Marketing Operations SpecialistWho we areRecharge is the leader in powering physical subscriptions, making it one of the most important ecommerce engines. Recharge powers over 50M subscriptions worldwide and has processed more than 10B in transactions. More than 15K brands such as Verve Coffee Roasters, Bokksu, Who Gives A Crap, Billie, and Bite Toothpaste Bits rely on Recharge daily to grow their businesses and delight their customers.Recharge’s mission is to enable brands and merchants to form strong, lasting relationships with their customers through recurring purchases. As merchants seek ways to drive more direct sales and distribution through their channels and move away from a reliance on traditional online marketing strategies, Recharge has made it possible to grow businesses with seamless, recurring customer transactions.Bootstrapped until 2020, Recharge is valued at over 2.1B dollars and is a double unicorn with a total raise of 277M dollars. Join us as we work with our merchants to define the future of ecommerce.OverviewWe’re looking for a Marketing Operations Specialist to join our team to own projects and initiatives to help drive growth. We need an individual who is looking for an opportunity to make an impact by partnering with our marketing team. They will improve upon our existing frameworks and processes, which support everything from marketing automation, lead-generation, email execution, attribution and additional marketing and sales integrations. This role will provide exposure to all facets of marketing and revenue roles and is critical to our continued success at Recharge and will report to the Director of Marketing Operations.What You’ll DoLive by and champion our values: #day-one, #ownership, #empathy, #humility.Build upon and help maintain our Hubspot instanceBecome a strategic partner to our marketing stakeholders and be responsible for the day-to-day execution of requests and projectsEnsure data integrity and proactively identify opportunities for process improvements and optimizationAssist in defining and measuring success across teams and platformsOperationalize marketing initiatives (build workflows, create reports, execute emails, implement and maintain new tech) Work closely with peers on the marketing and sales teams to ensure alignmentWhat You’ll Bring2+ years of Hubspot/Marketo experience is required1+ years of experience in a B2B or SaaS businessExperience with tools such as Google Analytics, Google Tag Manager, Salesforce, Drift, Triblio and Looker are nice-to-havesExceptional attention to detail and organizational skillsResourcefulness and willingness to learn: you’ll figure out what needs to be done and find ways to make it happenCuriosity and analytical thinkingWillingness to communicate openly and honestly with your teamAbility to work remotely and a desire to make an impact at a high-growth start-upRecharge | Instagram | Twitter | FacebookRecharge Payments is an equal opportunity employer. In addition to EEO being the law, it is a policy that is fully consistent with our principles. All qualified applicants will receive consideration for employment without regard to status as a protected veteran or a qualified individual with a disability, or other protected status such as race, religion, color, national origin, sex, sexual orientation, gender identity, genetic information, pregnancy or age. Recharge Payments prohibits any form of workplace harassment. Transparency in CoverageThis link leads to the Anthem Blue Cross machine-readable files that are made available in response to the federal Transparency in Coverage Rule and includes network negotiated rates for all items and services; allowed amounts for OON items, services and prescription drugs; and negotiated rates and historical prices for network prescription drugs (delayed). EIN 80-6245138. This link leads to the Kaiser machine-readable files.#LI-Remote | https://remotive.com/remote-jobs/marketing/marketing-operations-specialist-1619213 |
| Visible: Full Stack EngineerHeadquarters:URL: https://visible.vcWelcome!Visible is on a mission to help startup founders succeed. We’re achieving this by building best-in-class tools for startups and the venture capital investors who back them.Visible is a profitable, established software startup made up of 13 fully remote teammates across the globe and has been set up this way since Visible was founded in 2015 (we have this whole remote work thing down).Role Overview:We are looking for a full-stack, mid-to-senior-level engineer to join our small engineering team and help scale our product to support our next stage of growth. Here is what to expect:Our stack includes a Ruby on Rails API, PostgreSQL, Redis and Ember.js. We deploy to Heroku and Vercel and use Docker for local development. We have many different challenges that range from implementing product features to DevOps-type work and performance optimization. Other notable tools & frameworks you will be working with include Tailwind CSS, AWS, Mobiledoc, and a lot of 3rd party APIs.We favor full-stack engineers who have a good understanding of the entire scope of an application, but you don’t need to know both Rails and Ember to apply (however, for this position experience with one of the js frameworks is preferred and Ember experience is a big bonus).You will work closely with our engineering team, product designer, and CEO, helping guide product direction and execution. Some things you might find yourself working on in the first couple of months:Participate in a cycle where you are actively pitching, shaping, and building product features.Build new and improve existing integrations.Help rebuild our marketing website.Pair with other engineers on the team and our product designer, participate in engineering calls (we do weekly mob programming sessions).Working at VisibleWe empower our people. As long as it is aligned with the company vision, everyone has a lot of liberty in choosing what to work on. We have a combined approach, both data-driven and user-driven. We work hard to create a culture where people ask questions and challenge what is being worked on.Given that we are distributed, we end up working across multiple time zones and put an emphasis on being able to work asynchronously.We document everything we do in Notion, Slack, and GitHub.We use Slack for daily lightweight stand-ups.We meet virtually as a team 3x per week. This typically includes an all-hands, product standup, and a fun wild card day (we often play codenames or jackbox.tv).Offsites throughout the year for fun and strategic planning.We have adopted a modified version of the “Shape Up” process that fits our business and workflow. It allows us to build a high-quality product, take time to cool down, and not have to worry about looking at roadmaps that will change in the next six weeks anyway.We have a full-time product designer, but everyone on the team is capable of producing shippable UIs and we really value a good sense of aesthetics.We care more about quality than quantity. We spend time reducing our code and product debt. We pair whenever it is needed, we test our code, and we code review every line that goes in production. It is a great way to ensure quality and learn from each other.Qualifications & What We’re Looking For:The following are all guide rails. Don’t feel like you need to neatly check each box. If you love the role, we’d love to hear from you.You have at least 2 years of production experience with Rails/Ruby and/or EmberYou are comfortable working with multiple levels of the stack (JS, backend, database)You want to be part of a small, growth-minded teamYou care about writing clear, well-tested, maintainable codeBonus points if youWorked on Ember projects before (and enjoyed it)Have experience working with 3rd-party APIs, designing RESTfull APIsHave experience or interest in DevOpsHave previous experience building a startup product for scaleWhy Choose Visible:💥Visible Impact: We’re a small yet highly efficient team. This means your work will have a direct and visible impact on the growth of our company.💵 Ownership: Both in the work you do and equity in the company.✈️ Flexibility: Fully remote work (able to work within at least 3 hours of US eastern time zone).💻 Tech: We provide the tools you need to get your job done.⚕️Benefits: 100% Health, Dental, and Vision coverage + 401(k)🌴 Team Offsites: Two paid team offsites per year (the last few offsites were in Mexico, Barcelona, and Amsterdam).📖 Vacation Time: We all need a break sometimes. Visible employees get unlimited PTO.🏢 Space: If you’d like to work in a coworking space or upgrade your home office, we’re happy to help.⭐️ Culture: A team that makes you feel cared for.Compensation:Annual Salary: $90,000 – $120,000 (USD), depending on experience and locationThe Interview ProcessWe’ll review your application. So long as you are thoughtful in your application, we aim to get back to you within one week.Part I: Phone Screen with a team member. We’d love to hear about your development experience but more importantly answer any questions that you have.Part II: A more technical deep dive with one of our senior engineers.Part III: A coding project that will be related to your work. It will take less than a day to compete and we will pay you for your work.Part IV: A final call to chat about the project and get to know the rest of the team.To apply: https://weworkremotely.com/remote-jobs/visible-full-stack-engineer-1 | https://weworkremotely.com/listings/visible-full-stack-engineer-1 |
| Huntress | Apply NowStaff Data Engineerat Huntress (View all jobs)Remote US and CanadaReports to: CTOLocation: US and Canada Only, fully remoteCompensation Range: 45,000 to 60,000 base plus bonus and equityWhat We Do: Founded in 2015 by former NSA cyber operators, Huntress was built on a simple premise: to force hackers to earn every inch of their access.Today’s cyber-attacks aren’t limited to large organizations with the security tools that can ward off threats. Hackers don’t discriminate and will find a way to penetrate any vulnerability in any size business. Huntress enables IT providers and resellers to stop hidden threats that sneak past preventive security tools.Through a combination of expert human threat hunters, a comprehensive platform, and a desire to make the world a safer place, we’re working to deliver cybersecurity to the 99%—those small to midsize businesses that make up the backbone of our economy. Join the hunt and help us stop hackers in their tracks!What You’ll Do: You will be an integral part of helping Huntress continue its growth trajectory. You will work closely with all areas of the business to use data to make the unknown, known or the unclear, clear. The business is wanting to make data-driven decisions, thus our solutions need to be able to scale to support a data-starved organization. Responsibilities: You’ll get to be hands-on with the latest technology and provide thought leadership directly to the business to help Huntress grow. Build and implement complex data solutions in the cloud leveraging AWS, Snowflake, DBT and Fivetran.Uncover data quality anomalies and work closely with the product teams to recommend remediationsInvestigate, recommend, and implement data pipelines to support our growing businessDocument data ingestion and ETL program designs, present findings, and conduct peer code reviews.Develop and execute test plans to validate code.Design and implement formal data warehouse testing strategies to support the various functional groups.implement end-to-end data analytics solutions (from data ingestion through visualization) for a rapidly growing startup with a complex data environment. Communicate complex technical topics to non-technical business and senior executives and assist with internal solution scoping, architecting, and be an internal champion for data-driven solutions. Help grow the business by developing data models using predictive modeling to increase and optimize customer experiences, revenue generation, ad targeting, and other business outcomes.Assist in handling aspects of the life cycle of Machine Learning including Data Transformation, Exploratory Data Analysis, Feature Engineering, Model Trial Pipelines, Measuring Performance, Retraining, and Deploying models for Inference hosting.What You Bring To The Team: 6+ years of experienceExperience configuring data solutions in a cloud environment(s)Experience using cloud storage and computing technologies such as BigQuery, RedShift, or Snowflake.Experience developing complex ETL programs within the cloud Must have a bachelor’s degree in Computer Science, Technology, Computer Information Systems, Computer Applications, Engineering, or a related field.Demonstrated experience working in all phases of full life cycle data analytics development: Requirements, Architecture, Design, Testing, and deploymentStrong presentation skills to be able to author slides to help influence the company’s directionExperience using Data Science languages (R, Python) to manipulate data and draw insights Knowledge of a variety of Machine Learning and advanced analytical techniques and their real-world advantages/drawbacks.What We Offer: 100% remote work environment – since our founding in 2015Generous paid time off policy including vacation, sick time, and paid holidays12 weeks paid parental leaveHighly competitive and comprehensive medical, dental, and vision benefits plans 401(k) with 5% contribution regardless of employee contributionLife and Disability insurance plansStock options for all full-time employees One-time 00 stipend to build/upgrade home officeAnnual allowance for education and professional development assistance 5 USD/month digital reimbursementAccess to both Udemy and BetterUp platforms for coaching, personal, and professional growthHuntress is committed to creating a culture of inclusivity where every single member of our team is valued, has a voice, and is empowered to show up to work every day as their full self. We do not discriminate based on race, ethnicity, color, ancestry, national origin, religion, sex, sexual orientation, gender identity, disability, veteran status, genetic information, marital status or any other legally protected status. We do discriminate against hackers who try to exploit small businesses.Accommodations:If you require reasonable accommodation in completing this application, interviewing, completing any pre-employment testing, or otherwise participating in the employee selection process, please direct your inquiries to [email protected]. Please note non-accommodation requests to this inbox will not receive a response. If you have any questions about your personal data privacy at Huntress, please visit our privacy page.#BI-RemoteApply for this Job* RequiredFirst Name *Last Name *Email *Phone *Location (City) * Locate me Resume/CV *Attach Dropbox Google Drive or enter manually(File types: pdf, doc, docx, txt, rtf)Cover LetterAttach Dropbox Google Drive or enter manually(File types: pdf, doc, docx, txt, rtf)Will you now or in the future require sponsorship for employment visa status? (e.g. H-1B, E-3, TN status) *–Are you authorized to work for any employer in the United States? *–If applicable, please share a link to your professional website, portfolio, Github account or similar site herePlease provide LinkedIn profileWere you referred to Huntress by one of our employees? If so, whom?How did you hear about Huntress? Company page, job posting, event, somewhere else?Voluntary Self-IdentificationFor government reporting purposes, we ask candidates to respond to the below self-identification survey. Completion of the form is entirely voluntary. Whatever your decision, it will not be considered in the hiring process or thereafter. Any information that you do provide will be recorded and maintained in a confidential file.As set forth in Huntress’s Equal Employment Opportunity policy, we do not discriminate on the basis of any protected group status under any applicable law.GenderPlease selectGenderAre you Hispanic/Latino?Please selectAre you Hispanic/Latino?Race & Ethnicity DefinitionsIf you believe you belong to any of the categories of protected veterans listed below, please indicate by making the appropriate selection. As a government contractor subject to the Vietnam Era Veterans Readjustment Assistance Act (VEVRAA), we request this information in order to measure the effectiveness of the outreach and positive recruitment efforts we undertake pursuant to VEVRAA. Classification of protected categories is as follows:A disabled veteran is one of the following: a veteran of the U.S. military, ground, naval or air service who is entitled to compensation (or who but for the receipt of military retired pay would be entitled to compensation) under laws administered by the Secretary of Veterans Affairs; or a person who was discharged or released from active duty because of a service-connected disability.A recently separated veteran means any veteran during the three-year period beginning on the date of such veteran’s discharge or release from active duty in the U.S. military, ground, naval, or air service.An active duty wartime or campaign badge veteran means a veteran who served on active duty in the U.S. military, ground, naval or air service during a war, or in a campaign or expedition for which a campaign badge has been authorized under the laws administered by the Department of Defense.An Armed forces service medal veteran means a veteran who, while serving on active duty in the U.S. military, ground, naval or air service, participated in a United States military operation for which an Armed Forces service medal was awarded pursuant to Executive Order 12985.Veteran StatusPlease selectVeteran StatusForm CC-305OMB Control Number 1250-0005Expires 05/31/2023Voluntary Self-Identification of DisabilityWhy are you being asked to complete this form?We are a federal contractor or subcontractor required by law to provide equal employment opportunity to qualified people with disabilities. We are also required to measure our progress toward having at least 7% of our workforce be individuals with disabilities. To do this, we must ask applicants and employees if they have a disability or have ever had a disability. Because a person may become disabled at any time, we ask all of our employees to update their information at least every five years.Identifying yourself as an individual with a disability is voluntary, and we hope that you will choose to do so. Your answer will be maintained confidentially and not be seen by selecting officials or anyone else involved in making personnel decisions. Completing the form will not negatively impact you in any way, regardless of whether you have self-identified in the past. For more information about this form or the equal employment obligations of federal contractors under Section 503 of the Rehabilitation Act, visit the U.S. Department of Labor’s Office of Federal Contract Compliance Programs (OFCCP) website at www.dol.gov/ofccp.How do you know if you have a disability?You are considered to have a disability if you have a physical or mental impairment or medical condition that substantially limits a major life activity, or if you have a history or record of such an impairment or medical condition.Disabilities include, but are not limited to:AutismAutoimmune disorder, for example, lupus, fibromyalgia, rheumatoid arthritis, or HIV/AIDSBlind or low visionCancerCardiovascular or heart diseaseCeliac diseaseCerebral palsyDeaf or hard of hearingDepression or anxietyDiabetesEpilepsyGastrointestinal disorders, for example, Crohn’s Disease, or irritable bowel syndromeIntellectual disabilityMissing limbs or partially missing limbsNervous system condition for example, migraine headaches, Parkinson’s disease, or Multiple sclerosis (MS)Psychiatric condition, for example, bipolar disorder, schizophrenia, PTSD, or major depressionDisability StatusPlease selectDisability StatusPUBLIC BURDEN STATEMENT: According to the Paperwork Reduction Act of 1995 no persons are required to respond to a collection of information unless such collection displays a valid OMB control number. This survey should take about 5 minutes to complete.Powered by Read our Privacy Policy | https://boards.greenhouse.io/huntress/jobs/5541371003?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Malaria Consortium | The VacancyThe CompanyWhat We DoDocumentsHealthCommunityResponseDistrict Surveillance M&E OfficerSalary24.374,00 USD AnnualLocationQuelimane, Zambézia, Mozambique This is a permanent, full time vacancy that will close in 4 days at 23:59 GMT.The VacancyMalaria Consortium is recruiting for a District Surveillance M&E Officer to join our team in Quelimane, Zambézia, Mozambique.The District SM&E Officer will provide technical support on the implementation of project SM&E and MOH activities at district, health facility and APE levels and contribute specifically to improved data quality, data analysis, reporting and data use.The successful candidate will have:Graduate degree in epidemiology, public health, statistics or other related fields with at least 3 years of relevant experience; Experience working at the national level on health systems management and coordinating with both governmental and technical partners;Experience in leading ongoing data analysis for relevant use for malaria control/elimination programs, key indicators, and data visualization tools;Strong analytical skills in monitoring and evaluation of programmes and projects;Fluency in Portuguese and English requiredWe need to keep beneficiaries safe so our selection process reflects our commitment to safeguarding. Please find our Code of Conduct, Safeguarding Policy and Privacy Notice here. Due to the nature of this role we will be reviewing applications on an ongoing basis and the role might be filled and closed before the closing date. Early applications are encouraged.To apply for this position you will need to have the right to work in MozambiqueThe CompanyEstablished in 2003, Malaria Consortium is one of the world’s leading non-profit organisations specialising in the prevention, control, and treatment of malaria and other communicable diseases among vulnerable populations.Our mission is to save lives and improve health in Africa and Asia through evidence-based programmes that combat targeted diseases and promote Universal Health Coverage.What We DoWe are dedicated to ensuring our work is supported by strong evidence and remains grounded in the lessons we learn through implementation. We explore beyond current practice, to try out innovative ways – through research, implementation, and policy development – to achieve effective and sustainable disease management and control. DiseasesRead about thisAdvocacyRead about thisResearchRead about thisLearningRead about thisBelow are some useful links to check out:Policies & ProceduresFAQsDocumentsJD District Surveillance M&E Officer (1).pdf – DownloadYour Email AddressApply NowAlternatively, sign-in with… Google LinkedIn FacebookPublished4 days agoClosingin 4 days Share This Vacancy | https://malariaconsortium.current-vacancies.com/Jobs/Advert/3049514?cid=2061&t=District-Surveillance-MAndE-Officer |
| Customer Growth Specialist Welcome to CommentSold CommentSold is the North American leader in live selling technology (ranked by G2), enabling over 7,000 small to mid-sized retailers with live-selling tools, generating 147M+ items sold with $3.5B+ in lifetime GMV. CommentSold’s technology continues to provide small businesses, mid-sized brands and retailers with best-in-class solutions for delivering engaging live video commerce experiences. Recent innovations from the company include their lightweight video commerce plugin technology, Videeo, which allows any retailer or brand the ability to embed and go live with engaging, branded live video commerce experiences within days by easily integrating into their existing e-commerce stack. For more information, please visit CommentSold.com or Videeo.liveCustomer Growth SpecialistAs our Customer Growth Specialist, you will cultivate and grow relationships with our existing customer base. Through regular engagement, business consulting, and product education, you will help our customers best utilize the CommentSold platform to grow and scale their businesses.In this role, you willCoach customers to grow their business by partnering with them on goal development, and providing data-based, tailored, and structured recommendations to achieve those goalsServe as the main point of contact for our customers to build trusting and lasting relationships with the customer and their stakeholders, navigating organizations to identify key decision-makersBe meticulous about maintaining expert-level product knowledge and keeping our customers informed of feature changes and updates, as well as potential errors or outagesHost webinars, training, and ongoing success tutorials as neededRun reviews with all clients: identify areas for improvement, including opportunities for product adoption and implementing new CommentSold features, and make clear recommendations for building high customer satisfactionIdentify churn risk and take proactive steps to eliminateConfigure our software to ensure it meets the customer’s workflow needsServe as the voice of the customer to communicate and collaborate cross-functionally to drive product improvements that better serve our customer baseOwn the growth of your customers by meeting or exceeding 100% of your quota regularly and maintaining SLAsDemonstrate an in-depth understanding of e-commerce trendsContribute actively to the CommentSold internal knowledge base of best practices If you’re right for this role, youHave 3-5 years of Account Management experience, supporting large and/or complex accounts preferably in a SaaS environment; relationship management is your strengthHave experience providing customer value and driving retention; you should be merchant-focused in all that you doEnjoy working closely with customers to ensure complete satisfactionHave experience or training in managing small to mid-sized projects; you’ll be working with 200+ merchants and their big-picture strategyHave experience in eCommerce (understanding of acquisition, conversion, retention); our merchants will look to you as an expert source of adviceEnjoy providing a high-touch user experience, talking about technical concepts, have great analytical skillsCan empathize with users and quickly grasp the issues they’re facingEnjoy solving open-ended problemsLove constantly learning about a changing technical product, even when it’s a little out of your depthHave solid communication skills both written and oral, and be able to communicate complex concepts clearlyHave excellent analytical and data manipulation skills (Excel, Google); enjoy leveraging data to make decisions and get to the root cause of customer needsAre self-motivated, resourceful, competitive, over-achiever who does whatever it takes to get the job doneHave the ability to travel up to 10% of the timeHave the willingness to be available to your top customers outside of normal business hours when neededHave familiarity with Salesforce, Totango, Zendesk, Slack, and other SaaS tools preferredBase Salary – $56,000 – $70,000 (Depending on experience and level; Variable comp and bonus eligible)This role is full-time, remote (US only) Join CommentSold At CommentSold, you can work from anywhere in the United States thanks to the power of the internet – we put extra effort into our remote culture to ensure we exceed the engagement we all need. We value our team and show that through competitive salaries and bonus opportunities. Health, dental, vision, and life insurance are available to all full-time employees. We’re creating a space for equality across the board, and we support folks of all identities and lifestyles in everything we do. Join CommentSold to live your best life — we’re always excited to grow our team’s perspective. #lovewhereyouwork Competitive Compensation: We want every team member to be rewarded for their value and feel secure in their financial wellness. We conduct market analysis to ensure fairness and continued growth. We also offer bonus opportunities to reward folks for their contributions to our collective success when our company does well.Vacation, Holidays, & Sick Time: Designed to give you flexibility and balance, we offer full time, exempt employees unlimited vacation policy. We observe 9 annual holidays along with an end-of-year, weeklong winter break, and a sick time policy.100% Match 401k: We encourage investing in your financial security by matching contributions dollar-for-dollar for up to 3% of your annual salary, vested immediately. Option to enroll as soon as you join the team.Health, Dental, and Vision: We offer 100% employer-paid health (Cigna), vision (Principal), and dental (Principal) insurance. With extensive provider networks and plan options for different coverage needs, our team is well taken care of!Unlimited Virtual Care through First Stop Health: Coverage offers a range of support, from medical to mental health needs. Paid Parental Leave: When you welcome a new child to the home (by birth or adoption) we support up to 12 weeks leave for primary caregivers and 4 weeks for secondary caregivers to bond with their child without worrying about financial stability.$1200 Work Well Allowance: We provide the essentials, but to ensure you have a comfortable, productive workspace each full-time employee gets a $1,200 annual allowance for expenses like coffee, internet, and co-working fees.$500 Be Well Allowance: Everyone invests in their mind and body differently, so we provide a $500 annual allowance to spend on your wellness needs as you choose (think: new running shoes, gym membership, mental health, etc.). We love our valuesWe’re building a community, our chosen circle, around a set of values that guide how we work and interact with the world around us. Our cultural norms at work can’t be turned off when the computer’s away — we live these in every part of our lives. Our team isn’t for everyone, so if you’re right for it, the following values should resonate strongly with how you live your life.”Don’t Be An Asshole”: We’re intolerant to bad vibes, and genuinely love where we work (and want to keep it that way). We choose our fam by looking beyond a skillset – because roles can change – and surround ourselves with folks we want to spend our lives with.”We Really Like Smart People”: We aim high and hire smart people to get there — folks that use logic and critical thinking to make the best decisions. We look beyond the problem and quickly build context to come to the right solution; our ever-changing and high-pace environment requires a team of great autonomous thinkers. “Got It”: When we say “got it,” our team knows we’re owning it, we’re following through, and we’ll deliver beyond expectations. Put the effort into figuring things out yourself (hey, we’re all busy), and actively collaborate if you haven’t Got it; ownership also means knowing when to seek help and to never suffer in silence.”We Work To Win”: We’re a rare team of folks that genuinely love to work hard because we know that putting in the effort gets the win — we’re the people that started our careers at the lemonade stand. Not at all costs, but we give it our all because our customers are hustling to grow their businesses, and the hustle’s more fun when we’re winning together.”Unrelenting Feedback”: We collaborate for more than the high-fives (although they’re pretty great), and our team thrives on timely and direct feedback. There’s no hesitation in being direct; since we’re surrounded by smart people, we embrace thoughtful and challenging perspectives. | https://remotive.com/remote-jobs/marketing/customer-growth-specialist-1619680 |
| Policy Exchange | | https://policyexchange.org.uk/research-fellow/ |
| UK Government, Climate Change Committee | | https://www.civilservicejobs.service.gov.uk/csr/jobs.cgi?jcode=1845371 |
| Center for AI Safety | | https://jobs.lever.co/aisafety/f0218805-28e2-4da5-a002-dddb8dfce7fd |
| In-Q-Tel | | https://careers-iqt.icims.com/jobs/1290/technology-architect-intern%2c-cyber-technologies/job |
| European Union, European Commission | | https://traineeships.ec.europa.eu/about |
| Proemion: Field Application Engineer (m/f/x) Remote in EuropeHeadquarters: Germany FuldaDescriptionWe are looking for you as Field Application Engineer (m/f/x) at the earliest possible date for our headquarters in Fulda, Germany or fully remote in Europe. With us, you can move things forward. There are short decision-making processes and a lot of creative freedom for you. Our corporate culture is characterized by internationality, diversity and agility as well as by a hands-on mentality. We are a fast-growing international industrial tech company at the forefront of the IoT and Telematics revolution with headquarters in Fulda. Outside of Germany, we have offices in the USA and South Korea, as well as numerous colleagues working remotely for us worldwide. Our headcount has more than tripled in the last six years from 60 to over 180 employees. With you, we want to continuously develop the company to the next level. In return, we offer youIntensive Onboarding and targeted individual trainings and development opportunitiesA high degree of creative and decision-making freedom and plenty of room for innovative workShort communication channels and well accessible team leaders1on1 focused on helping you growNo micromanagementFlexitime and choice between fully remote and home office days to guarantee a nice work-life balanceFor onsite work: a modern and open working environment with lounges, kicker-table, pool billard table and team events, flatrate for soft drinks, coffee, cereals, and fresh fruit as well as free parking spacesAdditional allowance for gym membership and childcareYour RoleYou are the first technical contact for your customersYou support your customers in all phases of the implementation of a telematics system together with a sales representative assigned to the customer Gathering requirements and advising on decision-making, assisting in the selection of parametersImplementation of customer requirements using an established tool chainSupport and training of customers, especially in the pilot phaseIntroduction of telematics into the customer series and advice on adapting customer processesSeries support and management of extensions and improvementsYou implement data analytics services for your customersDevelopment, documentation, and improvement of the customer onboarding process (introduction of the telematics solution at the customer)Evaluation and forwarding of suggestions for improvement and ideas from customer discussions to development and product managementActive participation in our continuous improvement processesExecute internal and external trainingsYour SkillsYou successfully completed your degree in the field of (electrical) engineering, computer science or a similar qualification and already have some experience in the field of mobile working machines or related areasYou have profound knowledge in data analysis with PythonYou have experience in the development and testing of embedded devices, ideally CAN and CANopen productsYou have knowledge in data analyticsYou have experience in using telematics systems and data to add value and/or achieve savingsIdeally, you have already gained insight into XML, Ethernet, Bluetooth, WLAN and GSM technologyYou are confident in using Microsoft OfficeYou have a good knowledge of German and English, both written and spokenYour technical understanding is very wellYou are a strong communicator, a team player, goal- and result-oriented as well as a highly structuredYou are willing to travel internationallyTo apply: https://weworkremotely.com/remote-jobs/proemion-field-application-engineer-m-f-x-remote-in-europe | https://weworkremotely.com/listings/proemion-field-application-engineer-m-f-x-remote-in-europe |
| United Nations, Institute for Disarmament Research | | https://unidir.org/job-posting?field_category_value=1 |
| Testlio | | https://testlio.com/job/product-manager-reports-team/?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Testlio | | https://testlio.com/job/engineering-manager-reports-team/?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Testlio | | https://testlio.com/job/engineering-manager-inputs-team/?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| RedWing Aerospace Laboratories | | https://angel.co/company/redwing-labs/jobs/1859904-human-resource-manager?utm_source=Techstars+job+board&utm_medium=getro.com&gh_src=Techstars+job+board |
| Feedtrail | | https://www.feedtrail.com/open-positions/?job=10&utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Dyania Health | | https://gr.linkedin.com/jobs/view/senior-ml-engineer-at-dyania-health-3491199807?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| GoExpedi | | https://jobs.lever.co/goexpedi/e66026db-4a1c-4280-8c8a-d108904520c2?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Dyania Health | | https://gr.linkedin.com/jobs/view/software-engineer-at-dyania-health-3491855514?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Dyania Health | | https://gr.linkedin.com/jobs/view/senior-software-engineer-at-dyania-health-3497905511?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Cloverly | | https://www.linkedin.com/jobs/view/enterprise-go-to-market-at-cloverly-3494231451?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| HiveWatch | | https://oxidized-pendulum-401.notion.site/Open-Roles-at-HiveWatch-5a6a78772e6b4ae0a972c800c3cf6b8b?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| dalia.co | | https://dalialabs.applytojob.com/apply/EWPYvQs4ei/Account-Executive?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Tourial | | https://apply.workable.com/tourial/j/8FC52BA5F1?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Dyania Health | | https://gr.linkedin.com/jobs/view/clinical-research-associate-at-dyania-health-3507410259?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Dyania Health | | https://www.linkedin.com/jobs/view/nlp-applied-scientist-at-dyania-health-3507411214?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Dyania Health | | https://www.linkedin.com/jobs/view/senior-nlp-applied-scientist-at-dyania-health-3511344560?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Cloverly | | https://www.linkedin.com/jobs/view/sales-development-representative-at-cloverly-3506623925?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Whistic | | https://workforcenow.adp.com/mascsr/default/mdf/recruitment/recruitment.html?cid=eb547a33-3a55-47ce-9c34-b85bc9451fb6&ccId=19000101_000001&lang=en_US&selectedMenuKey=CurrentOpenings&jobId=450787&utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Chargezoom | | https://chargezoom.freshteam.com/jobs/O3jv5r_M-bL0/saas-account-executive?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| GoSite | | https://www.gosite.com/careers?gh_jid=6548270002&utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| GoSite | | https://www.gosite.com/careers?gh_jid=6619541002&utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Cloverly | | https://www.linkedin.com/jobs/view/climate-solutions-at-cloverly-3516651916?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| GoSite | | https://www.gosite.com/careers?gh_jid=6659023002&utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| WireWheel | | https://boards.greenhouse.io/wirewheel/jobs/6656343002?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| ANRA Technologies | | https://www.anratechnologies.com/home/job/sr-mobile-developer/?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Huntress | | https://boards.greenhouse.io/huntress/jobs/5546233003?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Balto | | https://boards.greenhouse.io/balto/jobs/5549364003?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| Dyania Health | | https://gr.linkedin.com/jobs/view/front-end-engineer-at-dyania-health-3531317360?utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| backstitch | | https://www.backstitch.io/cs/c/?cta_guid=291f15ba-2a26-4ca6-8c3d-fd2246b80bc8&signature=AAH58kFJgUdMh39_Kc2oMujZfO6Wb2znMA&pageId=5610906026&placement_guid=db5fd7ab-2327-4f74-89d5-f0df5800c44b&click=1adffd6c-82cd-4db1-a836-e0a6105affab&hsutk=e7735f92900edd9461e35cba755a58fa&canon=https%3A%2F%2Fwww.backstitch.io%2Fcareers&portal_id=731034&redirect_url=APefjpHh2joP2iC2gBWav2pVx38nqlS0oPzadRYcrrJEw7HZAP9RZkrd4f_8LeIETayb3pnuAcr9uMJY4MQBkz8BLt-FUJrg6BeWyiKdDILhGHc9Jl6yYugXGUqvNKAnWC_O8JoCTz2dVmqqiGbJQEwbgSMpZEgWAw&__hstc=139043244.e7735f92900edd9461e35cba755a58fa.1679318064651.1679318064651.1679318064651.1&__hssc=139043244.1.1679318064652&__hsfp=1302673943&contentType=standard-page&utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| backstitch | | https://www.backstitch.io/cs/c/?cta_guid=767313f5-b86c-4499-9f8c-e431b9518565&signature=AAH58kGNwwhzLP7jrs0XXtIaOekNNFViUw&pageId=5610906026&placement_guid=6c84a022-06ed-4de9-b1d7-20702e84000b&click=c59dae80-5090-4177-9bca-0ffe5540c6d1&hsutk=e7735f92900edd9461e35cba755a58fa&canon=https%3A%2F%2Fwww.backstitch.io%2Fcareers&portal_id=731034&redirect_url=APefjpEZ4xY8dgHsFPNLH6WgKpeoL9mK-jJVbAiHldJCAoozCbn7mhQDtjiO7xSMNyIS94bqLD-DOCBhcnfY8dW0YdshEYInvcwoHH_T4P2ilC9VUisP6jSjycZ03hzfd_8XkK_1cfoC1AxIuvxrryqSeJnkKy5FFQ&__hstc=139043244.e7735f92900edd9461e35cba755a58fa.1679318064651.1679318064651.1679318064651.1&__hssc=139043244.1.1679318064652&__hsfp=1302673943&contentType=standard-page&utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| backstitch | | https://www.backstitch.io/cs/c/?cta_guid=7771380d-86c8-4381-904b-003957426911&signature=AAH58kFgfkkpnAE9UEdWKxaan9bAJXJFtg&pageId=5610906026&placement_guid=9ae86810-3071-423f-83f8-7c37ab20081f&click=36d863cd-e35a-4e69-ac76-56b165c15eba&hsutk=e7735f92900edd9461e35cba755a58fa&canon=https%3A%2F%2Fwww.backstitch.io%2Fcareers&portal_id=731034&redirect_url=APefjpGy35kmgHaToDcIg1uyGedk2JaANjRUmXnKVA12Zg2uSOuNaAhticmdg3kByNhJSyviHMbarWrlANfFRF0GIm3cfX4wsJiLT9D4xRNhpZfRbF4XVq3oSArBfI4Vn2ml5_gdZJmWYoFf3g1bv0KS-1N15gU9jg&__hstc=139043244.e7735f92900edd9461e35cba755a58fa.1679318064651.1679318064651.1679318064651.1&__hssc=139043244.1.1679318064652&__hsfp=1302673943&contentType=standard-page&utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |
| backstitch | | https://www.backstitch.io/cs/c/?cta_guid=365dddb6-74ab-4139-8251-79739644b2b1&signature=AAH58kEVMPb5Qq5a71cp3Xh1VKqwqn1yLg&pageId=5610906026&placement_guid=f32b2ebe-b9d8-42d4-a8e4-61265e38cad2&click=dfebde5c-14de-4fe2-9329-639ce1b027bb&hsutk=e7735f92900edd9461e35cba755a58fa&canon=https%3A%2F%2Fwww.backstitch.io%2Fcareers&portal_id=731034&redirect_url=APefjpEDQXGSZsq9tJz9i9qj9crr2xHM3TSru_NQDj-7Plxv_n7_3jYv5IMKr3bhcC8DqIybrao5MaYYLxX8wo4iMALpBjHHkzdAd8V-lP_OHQqWL4Xp2ZaqsE5F9vwD7u1RjlA9p0azRjlOlSM2joHOfLujalq0_g&__hstc=139043244.e7735f92900edd9461e35cba755a58fa.1679318064651.1679318064651.1679318064651.1&__hssc=139043244.1.1679318064652&__hsfp=1302673943&contentType=standard-page&utm_source=SaaS+Venture+Capital+job+board&utm_medium=getro.com&gh_src=SaaS+Venture+Capital+job+board |